SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007947 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007947
Domain Number 1 Region: 29-164
Classification Level Classification E-value
Superfamily Cupredoxins 1.16e-42
Family Ephrin ectodomain 0.0000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007947   Gene: ENSONIG00000006303   Transcript: ENSONIT00000007952
Sequence length 200
Comment pep:novel scaffold:Orenil1.0:GL831229.1:1598336:1634362:-1 gene:ENSONIG00000006303 transcript:ENSONIT00000007952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTLLWAPGTPPGWKATIVFFNIISAVVAKRHTVFWNSTNTRLTAGDLSVQLNFNDYLDI
YCPHYPNEEAVGHGQPETLALYLVGEESFQGCVETRGAIKRWECNTPFAPFGPVRFSEKI
QRFTPFSLGFEFLPGRHYYYSSLPTDEGPPLPCMKLRVTVCCAPTSEGSKQKQEKVPRSS
GSSLRTASSPLLLIILLLTT
Download sequence
Identical sequences I3JGF6
XP_005472718.1.78416 ENSONIP00000007947 ENSONIP00000007947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]