SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007950 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007950
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily Cupredoxins 4.44e-40
Family Ephrin ectodomain 0.0000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007950   Gene: ENSONIG00000006304   Transcript: ENSONIT00000007955
Sequence length 184
Comment pep:novel scaffold:Orenil1.0:GL831229.1:1722962:1733053:1 gene:ENSONIG00000006304 transcript:ENSONIT00000007955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRREGYTMQVNVNDYLDIYCPHYNDSQRMVGTGEQYVLYMVSYRGYRSCDPQMGFKRWEC
NRPHAPHAPIKFSEKFQRYSAFSLGYEFHVGQEYYYISTPTHHHGRACLRLRVYVCCSTA
SDVDDEPGPTDGVYTLRPGLKIDELAEFNPVIPKLEKSVSGSSPSRDRLLLTVTMLFLAA
LCIS
Download sequence
Identical sequences I3JGF9
ENSONIP00000007950 ENSONIP00000007950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]