SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007951 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007951
Domain Number 1 Region: 26-156
Classification Level Classification E-value
Superfamily Cupredoxins 1.22e-48
Family Ephrin ectodomain 0.0000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007951   Gene: ENSONIG00000006305   Transcript: ENSONIT00000007956
Sequence length 211
Comment pep:novel scaffold:Orenil1.0:GL831229.1:1773767:1783018:1 gene:ENSONIG00000006305 transcript:ENSONIT00000007956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRRREAMDVVCLLCLVLTIGSWFASAERHSVYWNSSNANFQWDEYTVEVRINDYLDIICP
HYTHGEVPSHAAERYVLYMVEREDYEVCKPHSFDQLRWECSRPFAPHAPEKFSEKFQRFT
PFTLGKEFRQGESYYYISKPMHHHGKDCLRLRVDVVGHKGSGGVHNPSNHLPADDPAAME
PNVQRSIGNSAAQLVSRSLLFALTPVLLALM
Download sequence
Identical sequences I3JGG0
ENSONIP00000007951 ENSONIP00000007951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]