SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007977 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007977
Domain Number 1 Region: 335-444
Classification Level Classification E-value
Superfamily SRCR-like 3.53e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 2 Region: 98-201
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000095
Further Details:      
 
Domain Number 3 Region: 879-986
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000986
Further Details:      
 
Domain Number 4 Region: 552-657
Classification Level Classification E-value
Superfamily SRCR-like 1.28e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 
Domain Number 5 Region: 997-1100
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 6 Region: 446-549
Classification Level Classification E-value
Superfamily SRCR-like 9.16e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 7 Region: 1-96
Classification Level Classification E-value
Superfamily SRCR-like 1.14e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00015
Further Details:      
 
Domain Number 8 Region: 728-790
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000177
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007977   Gene: ENSONIG00000006326   Transcript: ENSONIT00000007982
Sequence length 1110
Comment pep:novel scaffold:Orenil1.0:GL831179.1:1620551:1690967:1 gene:ENSONIG00000006326 transcript:ENSONIT00000007982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSTRCSGRVEIYHSGSWGTVCDDDWDLNDAGVVCRQLGCGAAESVHQSAHFGQGTGQIWL
DNVACSGTESSLTACQHRGFGTHNCGHSEDAGVTCSVGQIRLVGSTQCSGRVEIYHRGSW
GTVCDDDWDLNGAKVVCRQLGCGAAVNAYPSAHFGQGTGQIWLDDVACSGSESSLTACRH
SGFGTHNCGHGEDAGVACLGENISNVNLDNEGSYQCQFQRDLIPDSNAPLSDSHHLASTL
NTVIRQLSSNQSFSSTTLPKLLSHCDEVYCSQFLCHISYRSLSSCPLAASGIPVVSRSCP
EFFICSGYDHACLSLSNLIAASAGLACGLSELKQCRDDGQIRLTGSSKSCSGRVEIYYSG
SWGTVCDDDWNIHDAQVVCRQLGCGAAVEATSSAHFGQGSGHIWLDNVGCSGSEHYLTEC
QHNGFGTHNCGHSGDAGVVCSGMVDVQVRLVGPNRCSGRAEIYYNSAWGTVCDDGWDMND
VQVVCKQLNCGIALEAPAVAHFGEGHEQIWLDDVACSGSESSLTECGHNGFGAHNCRHGE
DAGVICSGEKAGQIRLAGSTRCIGRIEIYHSGSWGTVCDDDWDINDAKVVCRQLGCGTAV
TATQSARFGQGTGQIWLDDVGCSGKERYLTECGHNGFGTHNCGHGEDAGVVCSGKHILVP
ATGPSEGIQAYEEQQWDPALDGDFWFSVIQVIVVKGVCKERVTLLTHFVFPEKGLLYNSE
IFITDGQKPSISINPAGAVTWGQNVAITCSISADHVNFDSEGLYQCQFQRLSHQYLSTPL
SDYVRLSVTGKECIAESSTPHKVTQSDSVLLVRRNCSLSFSFLLWLCPATVLGIPGFSHP
QASELLCQNQERVTRYWDLDLSQPLGIRTHNNSSSYHRENGQIRLTGSGSTQCSGRVEIY
YSGSWGTVCDDSWELADAKVVCRQLNCGTALEAPQSARFGQGTGNIWLDDLACSGSERSL
TQCQHSGFGSHNCGHGEDAGVVCSVKQHVRCLTILTGVKLVGSNQCSGRVEIHYNNTWGT
VCDDNWDMNDAKVVCTELDCGTALEAPQSARFGQGTGRIWLDEVSCSGSERSLIQCQHRG
FGKHNCVHGEDAGVVCSGKLKYHISTTHAA
Download sequence
Identical sequences I3JGI6
ENSONIP00000007977 ENSONIP00000007977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]