SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007997 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007997
Domain Number 1 Region: 3-295
Classification Level Classification E-value
Superfamily Terpenoid synthases 2.88e-67
Family Isoprenyl diphosphate synthases 0.0000000158
Further Details:      
 
Domain Number 2 Region: 371-552
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000000314
Family RUN domain 0.011
Further Details:      
 
Domain Number 3 Region: 719-777
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000315
Family SH3-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007997   Gene: ENSONIG00000006344   Transcript: ENSONIT00000008002
Sequence length 779
Comment pep:novel scaffold:Orenil1.0:GL831229.1:2032441:2053539:1 gene:ENSONIG00000006344 transcript:ENSONIT00000008002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPQLFEDQFEELVTELTERDFTDPVLADALKRLREVLVYNTPGGKRNRGLSVIGSLRELV
PPSQLTQDTVQRALLVGWCIELLQAFFLVADDIMDGSVTRRGQPCWYKKDGIGLDAINDS
FLLEGSIYRLLRRYCRDQPYYVHLLELFNEVTFQTELGQALDLMTAPPTQIDLNRFTIER
YKAIVKYKTAFYSFYLPVAAAMYMAGISSEEEHNNAKHILLEMGEFFQIQGCYGQHDEAS
VEKVKALYNSLQMPSLYQKYEEESYQRLQKLIASHAQNLPHSVFLNFAKKIYKRNNSCSD
LESDCADQSASICSSQDQDNLSVSLSSKDHSLPQGPDSKPPARSEWHFKAPPRPPKLYQA
PLQSRVANLKEEKKALVGAVSVAVEAILAQFSSSRTVVQKALSGDSAVNPSLGRLVLQCL
CPALHSLLTDGLKPYQSDLIAGRRPNSAWSLVQASTRAGPKTHALFNLQVRVGELPQLRQ
SKHRFNAFLLGLLNTKLLDFWLSYLQSCSDVLETYYHPTSFMRLSQTACQPLFEELLLVL
QPLSLLTFNLDLLFQHHHLEPESHRPEIPSPPFPDPVIQQGWGAVVRWGGRLSQNLAELS
LSAVKKDEMNTDLPDLQAQAGSDYTPVSGGTQVPWGLSRLFGASKTPTSPTGHTQPTRSV
IKLQKLVLLIIISSVFQVSVISLRRPSQWFAPGVTALTRMVSSSSTPMPTEKPHGLDACE
KTIDPSVRTLCDHAGSGSELSFRKGEELVVLGGVDQDWIRCRQGDKEGLVPIGYTSLIM
Download sequence
Identical sequences I3JGK6
ENSONIP00000007997 ENSONIP00000007997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]