SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008001 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008001
Domain Number 1 Region: 38-126
Classification Level Classification E-value
Superfamily PUG domain-like 0.0000000000209
Family PUG domain 0.0067
Further Details:      
 
Domain Number 2 Region: 644-716
Classification Level Classification E-value
Superfamily RING/U-box 0.000000724
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 364-388
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000235
Family Ran binding protein zinc finger-like 0.003
Further Details:      
 
Domain Number 4 Region: 303-329
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000051
Family Ran binding protein zinc finger-like 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000008001
Domain Number - Region: 269-296
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000942
Family Ran binding protein zinc finger-like 0.0038
Further Details:      
 
Domain Number - Region: 525-559
Classification Level Classification E-value
Superfamily UBA-like 0.00167
Family UBA domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008001   Gene: ENSONIG00000006347   Transcript: ENSONIT00000008006
Sequence length 1004
Comment pep:novel scaffold:Orenil1.0:GL831354.1:772534:829475:-1 gene:ENSONIG00000006347 transcript:ENSONIT00000008006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANLPLPPCSKYHHIAAETMVIENSFGSNRKETLGSLQRLSTALNILEKYGCNLTNPNRP
KYWRTVKHNNPVFRATVDAIQGGRAVLCLYGYSNQQPDGLSFPDDVTDPDVGRVAAVTLE
VMSLRMELEMLIKEAHPHPEFYERIIPTLRHKVMTGIIPLWKNYPDLLTQLVSGPQVSVP
LWLPKNCAICGIFRISAHCLTCLQGLCSDCDRLYHSYPERANHHRTAVTSSSSSKNRSSD
GCTMRYRASPTQCKHAGVEALSSICDFSSSSTWRCLHCTKVNSIQDVLCEECEQPRLEPL
SPKEEWQCKSCTMVNAASSILCEVCERPRLATRPPVTVPNHNNSCLEALYIGQDPTIIQI
TLLQWVCQFCTYLNYSPAMVCEMCDLARPEPAPLPVKLRPPSPVRRVPALPIKPKEPAPE
DLDSWRQNLIKEEGLKLIQLIRHGEKKGVSPEEVYTSMRVAGDSNILPCKWLKTELPLLL
DQIRMLVATSSLQSFSEAEAKQAWLTAGGDTERAARQALRDRLAKVKELRALGFSDEARC
HEVLWQSGGEVRGALVLLQRPLLEPFHKRIWSEKPEPPVDIHHPDKQRVCRWLLAVYDLP
SWGRCELALSLLLEHSAPYSLEDVVQAVQESHDREFIKRVLAKECPICLSVFPHSKMQSL
TSCQCSVCCGCFQQHFTIAVRDKHIRDMVCPVCWEPDINDPEHLNSYFSTLDIQLHCHLA
NHNYKACHHLQLFFESTSLSLFPGFWTMYKIYKRLMYQNSCTQTFACQKIWVENELQTAE
QQFQNFNSKTYFHSFLRIFYIHESNIINTCDCDCQYQFLCYNYYYYYCGPVWKNLRATFV
RLFPSRCRCVSPNEGHSYECFCAVFSIGRDGYLNQTCNTVRNLGVIFDQDMSFNAHIKQI
YLCGVIEQKDEGGQQSDAACGAQTQPGHAGLCEKHYREYLVSLINSHSIDPAPLYSSNEL
LLACRRYKVDDTHTDGEDTFTYYTRLLEKLMDEVPLGDKVPRKK
Download sequence
Identical sequences I3JGL0
ENSONIP00000008001 ENSONIP00000008001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]