SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008248 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008248
Domain Number 1 Region: 5-163
Classification Level Classification E-value
Superfamily RUN domain-like 3.79e-29
Family RUN domain 0.0016
Further Details:      
 
Domain Number 2 Region: 706-873
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-18
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008248   Gene: ENSONIG00000006540   Transcript: ENSONIT00000008253
Sequence length 1021
Comment pep:novel scaffold:Orenil1.0:GL831308.1:235892:249452:-1 gene:ENSONIG00000006540 transcript:ENSONIT00000008253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQLKVKDRILENISLSVKKLQSYFAACEDETPAIRNHDRVLQRLCEHLDHALLYGLQDI
SSGYWVLVLHFTRREAVRQIDELQHIATNLGRSRAWLYLALSESSLESYLRLFQENQALL
HKYYFKDRNALVCSHDHLTLFLTLVSGLEFIRFDLELDVPYLDVAPYMPEYYKPQNLLDF
EERLPSSDSLSLHSFTSLTSTNLEWDDSAIAPSSEDYDFGDIFPVLQSLPSADWEEGDLT
DQASCPRSSGSDPQTVISDTVVLCTTVKVKPPPVSPHSPTFRHNPFNEDSDTNTSADVTP
VHVPSRHSSTTTGDDTEINSNELEVIRMAKRRKPTKKRRGKSFTDSISSTHNSISSEQVE
MESSITSVDADLVNCSIVKLYDEGELRRSRFGSEVLDEGRDDGTGLRLPEMTDTSMDSLG
QPLCDVIDQLNGALDREDTWEHPEEDKNSKCSYRSSEPPAQQPFRKDSGGKPPDPAPGET
PCSPLAKSPNFLPTSPVPADVCCFTPNSPDSAPTGGSHHDSTELSQSQTFSGGLEDEREA
EALAGQEPVMKEEEDAQTDKETFKAAEAQQVLQEEKLSPSESSHPAEFKVDNNHLLLLMI
HVFRENEEQLFKMLRMSTGHMEGDLQPLYLLLTDCYIYLLRKGAAEKPYTVEDAVSYNEL
DYISVGLDQQTVTLVCTNRRRKFLLDTADTSLTSWFLTILKSAMVKGCREPPYPSVLTDA
TMEKLALTKFVSQESHSEVSEVSIKLYSLVHWEDPMDMTLSPQGGPPNLGGFSSTKEGSL
QYRSGTTYLGKEQWKNCYLVLSNGILYLYAERTDVTPLLSVTMGGEHCGGCRRSNNTERP
HAFQVILTERPPLVLSANNEQDMAEWMQLLCQSVSKGVIPQGVSPTPCIPCCLVVTDKKL
LTCHQDCQTSFFRSLGSADICDVIAVSLEADMEYCVIEFAADRAQFLPPWVLYFSGCGER
DRLLQALDDAWKAIFQVELPHRDVSDPLVQKRCGEALELMKSAWQRADSLARGRAQREPW
C
Download sequence
Identical sequences I3JHA4
ENSONIP00000008248 ENSONIP00000008248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]