SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Oreochromis niloticus 69_1.0 > ENSONIP00000008291

Domain assignment for ENSONIP00000008291 from Oreochromis niloticus 69_1.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSONIP00000008291
Domain Number 1	Region: 1-85
Classification Level	Classification	E-value
Superfamily	Ubiquitin-like	1.27e-23
Family	Ubiquitin-related	0.00004
Further Details:

Domain Number 2	Region: 276-342
Classification Level	Classification	E-value
Superfamily	XPC-binding domain	3.4e-22
Family	XPC-binding domain	0.0000635
Further Details:

Domain Number 3	Region: 183-233
Classification Level	Classification	E-value
Superfamily	UBA-like	0.00000000000107
Family	UBA domain	0.0003
Further Details:

Domain Number 4	Region: 359-407
Classification Level	Classification	E-value
Superfamily	UBA-like	0.00000000000222
Family	UBA domain	0.00043
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSONIP00000008291 Gene: ENSONIG00000006571 Transcript: ENSONIT00000008296
Sequence length	410
Comment	pep:novel scaffold:Orenil1.0:GL831179.1:4116294:4123962:1 gene:ENSONIG00000006571 transcript:ENSONIT00000008296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MQITLKTLQQQTIQIEIDPEQTVKALKEKIEAERGKDNFPVSGQKLIYAGKILQDDTPIK DYKIDEKNFVVVMVSKKQKAKPAAAASPSVSEAPKPPVQDSGSTSTAAPTTNPTPAPAPA PAAVPIPSGEAKEESSAVATEPQQPASLPAYSSGGSQGLDASSTLGSHVDLQTSIQFLFQ TFTSALSVTGAEYEAMLTEIMSMGYERERVVAALRASFNNPHRAVEYLLTGIPSSPVQES NPPAQAPTSGTTEAPSVPEERGQSSLTVAHCFCALGENPLAFLRTQPQFLHMRQAIQQNP ALLPALLQQLGRENPQLLQQISQHQELFIQMLNEPVGEGGDAPEVGEMGAAGEEGAPVNY IQVTPQEKEAIERLKALGFPEALVIQAYFACEKNENLAANFLLNQGLEDD
Download sequence
Identical sequences	I3JHE7 ENSONIP00000008291 ENSONIP00000008291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]