SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008291 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008291
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.27e-23
Family Ubiquitin-related 0.00004
Further Details:      
 
Domain Number 2 Region: 276-342
Classification Level Classification E-value
Superfamily XPC-binding domain 3.4e-22
Family XPC-binding domain 0.0000635
Further Details:      
 
Domain Number 3 Region: 183-233
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000107
Family UBA domain 0.0003
Further Details:      
 
Domain Number 4 Region: 359-407
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000222
Family UBA domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008291   Gene: ENSONIG00000006571   Transcript: ENSONIT00000008296
Sequence length 410
Comment pep:novel scaffold:Orenil1.0:GL831179.1:4116294:4123962:1 gene:ENSONIG00000006571 transcript:ENSONIT00000008296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQITLKTLQQQTIQIEIDPEQTVKALKEKIEAERGKDNFPVSGQKLIYAGKILQDDTPIK
DYKIDEKNFVVVMVSKKQKAKPAAAASPSVSEAPKPPVQDSGSTSTAAPTTNPTPAPAPA
PAAVPIPSGEAKEESSAVATEPQQPASLPAYSSGGSQGLDASSTLGSHVDLQTSIQFLFQ
TFTSALSVTGAEYEAMLTEIMSMGYERERVVAALRASFNNPHRAVEYLLTGIPSSPVQES
NPPAQAPTSGTTEAPSVPEERGQSSLTVAHCFCALGENPLAFLRTQPQFLHMRQAIQQNP
ALLPALLQQLGRENPQLLQQISQHQELFIQMLNEPVGEGGDAPEVGEMGAAGEEGAPVNY
IQVTPQEKEAIERLKALGFPEALVIQAYFACEKNENLAANFLLNQGLEDD
Download sequence
Identical sequences I3JHE7
ENSONIP00000008291 ENSONIP00000008291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]