SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008357 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008357
Domain Number 1 Region: 94-328
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.53e-96
Family Caspase-activated DNase, CAD (DffB, DFF40) 0.000000156
Further Details:      
 
Domain Number 2 Region: 3-84
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.24e-26
Family CAD domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008357   Gene: ENSONIG00000006615   Transcript: ENSONIT00000008362
Sequence length 343
Comment pep:novel scaffold:Orenil1.0:GL831308.1:1156999:1160162:1 gene:ENSONIG00000006615 transcript:ENSONIT00000008362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSKMFGKIKPVKVRSCSENRKYGIAAKDVKELLKKACNLLQVPLSGARVCLYEDGTIVTE
EFFPTLADNTELVLLSKGQTWSGVVCDISQLLDTDRHADSLIEAAKGLLSDEKSSKRRKI
LTDLLQNLEDRSELESREEDEGWFQGVDSRFKTKSAYMKYNCESRIRGYLKELDDATKSI
QKAKVRAEFLKTSQSLTEMLKTAKYNGCYFDRTEKQPDRLCTQEGWFTCQGSFDEKVCKS
LHSINPYGSREGRIVFSTWNLDHRIEKKRTVIPALLEALQNHRSTDINLNYFYQLLFTRE
NLKLVHIVCHKKGSHNLQCDTKKIYNNATKDLKAKQKPKVKKR
Download sequence
Identical sequences I3JHL3
ENSONIP00000008357 ENSONIP00000008357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]