SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008390 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008390
Domain Number 1 Region: 27-314
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.44e-81
Family Regulator of chromosome condensation RCC1 0.013
Further Details:      
 
Domain Number 2 Region: 355-465
Classification Level Classification E-value
Superfamily POZ domain 2.57e-26
Family BTB/POZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008390   Gene: ENSONIG00000006640   Transcript: ENSONIT00000008395
Sequence length 531
Comment pep:novel scaffold:Orenil1.0:GL831237.1:102430:115014:-1 gene:ENSONIG00000006640 transcript:ENSONIT00000008395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDVTKWPIFSLMGPQELASIRKACVFGSSANEAIYITNDDEVFVFGLNCSNCLGTGDSL
STIVPKKLDFLSGRKVVSLSYGSGPHILLATEDGELFAWGHNGYSQLGNGTTNQGVAPVL
VSANLLNKKVTEVACGSHHSMALTDTGEVYAWGYNNCGQVGSGSTANQPTPRRVSSCLQN
KVAVSIVCGQTSSLAVVDNGEVYGWGYNGNGQLGLGNNGNQVTPCRLVGLQGLCVQQIVS
GYAHSMALTDEGLLYAWGANTYGQLGTGNKSNQLSPVQILTEKERIVEIAACHSTHTSAA
KTQSGQVYMWGQCRGQSIVLPHLTHFACTDDVFACFATPSVMWRLLSVEHDDFLTVAQSL
KKEFDNPETADLKFCVDGKYIYVHKAVLKIRCEHFRSMFQSHWNEDIKEVIEIDQFSYPV
YRSFLEFLYTDNVELPPEDAIGLLDLATSYCENRLKRLCQHIIKRGITVENAFSLLSAAV
RYDAEDLEEFCFKFCVNHLTEVTQTAAFWQIDGNLLKDFICRASRCGAFKN
Download sequence
Identical sequences I3JHP6
ENSONIP00000008390 XP_003451657.1.78416 ENSONIP00000008390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]