SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008443 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008443
Domain Number 1 Region: 256-412
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.24e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000358
Further Details:      
 
Domain Number 2 Region: 44-151
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-28
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 3 Region: 155-253
Classification Level Classification E-value
Superfamily LCCL domain 1.22e-23
Family LCCL domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008443   Gene: ENSONIG00000006685   Transcript: ENSONIT00000008448
Sequence length 680
Comment pep:novel scaffold:Orenil1.0:GL831237.1:573971:598403:-1 gene:ENSONIG00000006685 transcript:ENSONIT00000008448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAVMVGRGPTGAGVLVLSILIILTTESCGGQKGDGCGPSVLGPESGTLSSLGYPRTYP
NNTVCEWEISVPRDKRIHFLFALLDIEDSDCQVNYLRLYNGIGPNRSEIVKLCGLGLKVE
HLINSTGNEATVQFMSGTHHTGRGFYLSYSTTEHADLITCVDKGMNFTEAAYRKYCPAGC
LTSTEEISGTIPNGYRESSPLCVAAIHAGVVSNAAGGNISVVNSKGISHYEGTLANNVTS
TVGTRSDSLFTFTTNGCYGTLGLASGGVADTQLSASSALDWSTRVWAPSGARLKKEGLPW
APSQSDQLQWLQVDLKKEKRITGIITTGSALSEEKCYVSAYRVLYSNDGKQWSGYKESNS
VQDKIFQGNNNYGDEVRNNFIPPIVARFVRINPISWYKRIALKLELLGCQVPSERRTSDL
RPRMSPPRHTPGAAGTKHPPHLGQTTPTPNIRNTTMPPHTGKDVTLAAVLVPVLVMVLTL
ILIVVCACHWKNRKKTSEGTYDLPHLDGTADWWKSMKQLLPSKMVETEDSVRYSSSEVSR
LTGRGVVPGLHAEPAEYAQPLVSGVTTLGARSTFKPDDGPSPGYSDPDLYDAPISSGLCH
AYAEPLPSSGSEYATPIVVDMGLKQPSTLCNFMGARPGSLNPWTDSGQSGSMAYDRPKTS
TELATPTEDLTYQVLHPVKL
Download sequence
Identical sequences I3JHU9
ENSONIP00000008443 ENSONIP00000008443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]