SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008477 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008477
Domain Number 1 Region: 2-117
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-28
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 2 Region: 137-213
Classification Level Classification E-value
Superfamily LCCL domain 7.19e-20
Family LCCL domain 0.0014
Further Details:      
 
Domain Number 3 Region: 253-304
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000312
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008477   Gene: ENSONIG00000006710   Transcript: ENSONIT00000008482
Sequence length 312
Comment pep:novel scaffold:Orenil1.0:GL831244.1:28910:35732:-1 gene:ENSONIG00000006710 transcript:ENSONIT00000008482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGCGHTLLAPESGTLASQNYPGTYPSNTWCKWRLRVPQGRTLRLLFGDFDVESSPGCSFN
YLLINNKVKTFGGRIKGPLCGKLDAAGKNVTFNSNEVIIMFKSGPHRSGRGFLLSYATDQ
HPVVYEIQQCLEVLLLLLSVYCPAGCKKVTGDIWGNSEHGYRDTSVLCKSAVHAGATSDS
QGGHITVNRGRSLTLYESTFANGVLSKMYVFVFHIFKMRSCGNVQLLVYSFDRGSLSEKK
LLFIQDKNSQEQTKSWNSRNNDFSHNFLLWTADSSDQSPWVEMELSDRSTITGIVTTGSS
STLYFVITAFLP
Download sequence
Identical sequences I3JHY3
ENSONIP00000008477 ENSONIP00000008477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]