SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008499 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008499
Domain Number 1 Region: 505-694,904-1043
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.62e-62
Family Regulator of chromosome condensation RCC1 0.012
Further Details:      
 
Domain Number 2 Region: 3657-3847
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.68e-25
Family APC10-like 0.015
Further Details:      
 
Domain Number 3 Region: 2242-2285,2367-2410
Classification Level Classification E-value
Superfamily E set domains 0.0000000113
Family Filamin repeat (rod domain) 0.013
Further Details:      
 
Domain Number 4 Region: 4402-4477
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000336
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000008499
Domain Number - Region: 3626-3686,3965-4044
Classification Level Classification E-value
Superfamily ARM repeat 0.00912
Family Armadillo repeat 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008499   Gene: ENSONIG00000006728   Transcript: ENSONIT00000008504
Sequence length 4654
Comment pep:novel scaffold:Orenil1.0:GL831237.1:947031:1007602:1 gene:ENSONIG00000006728 transcript:ENSONIT00000008504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLGVRVISGAGADLSTVGSGMGSCPTPGVQSDCRTRYQLLLSGRALAERYRRIYTTAIN
DKEQGINQGRLFASRGKKALSKKKLKRRQKVKSKVKSRTKAESLDGALCVPDIKLHSNPS
AFNVYCNVRHCVLDWQQREASLALASRSSVQSGDSDSEEEEEYREPAVKLPKIIGIGLCG
VFELIKETRFSHPLLCLRSLQALLDMLQGQQPEGFQTEPPDVLESLFQLLLETTVRSTGP
NDPTGQAITALSCACLFSLVVAWGDTGKILQAVSAILTNNGSHACQTIQVPTILNALQRS
VQAVLVGKIQIQDWFGNGIKRAALMNKWVLKEVTIDEDERCLLQTDGSFLYLLCKDGLYK
VGSGYSGTVRGHVYNSTSRIRNRKEKRSWLGFAQGYLLYRDTSNHSMSALKINPETLEHE
GTVAMPGQHSDGQNIIFTDGEYINQIAACKDDGFVVRIYTMSSDPALQQELQLKLARKCL
HACGISLFDLEKDLHIISTGFDEEAALLGAGREFALMKTASGKIYYTGKYQSLGIKQGGP
SAGKWVELPVTKSPKIVQFSVGHDGSHALLVAEDGSVFFTGSASKGEDGESTKSRRQPKP
YKPKKMIKLETKTAVYTACNNGSSSIVTKDGELYMFGKDAIYSDSTCQVTDLKGHFVTQV
AMGKAHTCVLTKNGEVWTFGVNNKGQCGRDTGAMSQAGKAFGVENMATAMDEDLEDELEE
KEEKSMMCQPGMHKWKLDQCMVCTVCGDCTGYGASCVSSGRPDRVPGGICGCGSGESGCS
ACGCCKACARELDGQEARQRGIFDAVKEMIPLDLLLAVPVPPPPGVNIEEHIQIRQEEKR
QRINRRHRLEEGRGPLVFPGPIFMNQREQALARIRPLQALRHKRDKHKDGSSERGEKDAS
KITTYPPGAVRFDCELRAVQVSCGFHHSVVLMENGDVYTFGYGQHGQLGHGDVNSRGSPT
LVQALPGPSVQVTAGSNHTAVLLMDGQVFTFGSFSKGQLGRPILDMPYWNAKPSPMPNIG
AKYGRKATWIGASGDQTFLRIDEALINSHVLATSEIFASKHIIGLVPSSVSEPPPFKCLL
INKMDGSCRTFNDSEQEDLQGFGLCLDPVYDVIWRFLPATREMWCYNAVIADARMPSATD
LQARCSILSPELALPSGSHATTTRSHGALHILGCLDTLAAMQELKMGVASAEEETQAVMK
VYSKEDYSVVNRFESHGGGWGYSAHSVEAIRFCADADILLGGLGLFGGRGEYTAKIKLFE
LGPDGGDHETDGDLLAETDVLAYDCAAREKYAMMFDEPVLLQLGWWYVAWARVSGPSSDC
GSHGQATITTDDGVVFQFKSSKKSNNGTDVNAGQIPQLLYRLPSNDGNASKGKQQTSEPV
HILKRSFARTVSVECFESLLSILHWSWTTLVLGVEELRGLKGFQYTATLLDLERLRFVGT
CCLRLLRVYICEIFPIAASTKAVVEESSKLAECVGKTRSLLKKILSEGMDNCLTKLDNDP
QGYLSQPLTLLEAVLQECHNTFTACFHSFYPTPALQWACLCDLLNCLDQDIAEANFRTSS
SRLLAAVMSALCNTSVKLTSILPIAYDGEVLLRSLVKQVSTENDSALAHRFPLLVAHMEK
LSHTEENLMGMTSFREVLEKMLVIVVLPVRKSLRREVELFSPHLVSNTCGLLASIVSELT
ASALGSEVDGLNSLHSVKASPNRFTKTSQGRSWNTGNGSPDAICLTVDKPGVVLVGVCVY
GGGGIHEYELEVLADDTEHPGDSAHSHRWTSLELVKGTYSTDDSPSDIAEIRLDKAVPLK
EGVKYAVRLRNYGSRTANGDGGMTTVQCSDGVSFTFSTCSLSSNGTNQTRGQIPQILYYR
SEYDGDLQSQLLSKANEEDKNCSRALSVVSAVVRAAKDLLHRAFAVDVDDIPELLSSSSL
FSMLLPLILAYIGPVAASVPKAAVEVFGLVQELLPAVSALNQKYAPPTFNPNQSTDSTTG
NQPEQGLSACTTSNHYAVIESDHPYKQAGVTQYRVSFPDCVRWTTIEFDPQCGTAQPEDV
LRLLIPSRTLHLSNLGAKPLIHDTINTWTELKKFSGSTGWPTTVLVLPGNEVLFSLETAS
DYVKDEKACFYGFKCVAVGYEFNPGPDEGIIQLEKELAYLGSVCAAALMKKDLALPIGNE
LEEDLEILEEASLQVCKAHSGILGKGLALSHSPTILEALEGNLPLHIQTNEHSFLEDFIT
CVQNSSGGRLARWLQPDSYADPQKTSLILNKDDIRCGWPTTVVVQTKDQYGDVVHVPNMK
VEVKAVPVSQKKSVQPENVKKLQRLPGSCSPSSSGPDLTFGGLPVPKLEATYEPMIVKEA
RYIAITMMKAYENYSFEELRFASPTPKSPRRPSENMLIRANTDGTYSANWTPGAVGLYTI
HVTIDGIEIDAGLEVEVKDPPKGMIPPGTQMVKPKAEPQPSKVRKFVSKDSAGLRVRSHP
SLQSEQIGIVHVNGTITFIDEIHNDDGVWLRLNDETVKKYVPNMNGYTEAWCLSFNQHLG
RSLLVPADEVRGQSEENIKEVSSCPSHEAPIRVQNRAGQGGGPGLYKVVKTGPSGHNIRS
CPNLRGIPIGMLVLGNKVKAIGEVVNSEGTWVQLDKNSVVEFCESDEGEAWSLARDRGGN
QYLRHDDEQALLEHGNQTPPPSPFSVQAFNRASTSNGAQGFDYGISNNKGERGNLMPGAR
PMSPASKHRQENRSAKQESRGSRSSEQSRVKTSEGGLTASEALILRSDTAKLRSDSHSRS
HSPNHNTLQALKADGRTSGNRSESPNPGSRSSSPKQKSISTSGRSSPSSNSSQHSSSTHH
DKNLPPKVSPSSKAQLDPPRERSKSDSYTLDPDTLRKKKIPLTEPLRGRSTSPKPKLSPK
DPNKGMTGNAENRVPSPHVTQENLHSEVVEVCTSSALLSNEDVNDENVELRNAEEGSCKV
HFSIGKAPVEEELKSRSSPKVSRKTSSRHTRSKKDKSGPLFKGEGTTRITEPAKQAMSPS
VAECARAVFAAFLWHEGIVHDAMACSSFLKFNPDLTKEHAPIRSSLGGQGAEEKESKLKN
RHSLEISSALNMFNIAPHGPDISKMGSINKNKVLSMLKEPPLPEKCEDGKGESISYEMTS
HPSMRAKSILPLTLQHLVAFWEDISMATIKAATQNMIFPSPGSSAILKKKEHEKDSKKAK
KEKKKREKAEVRPRGNLFGEMAQLAMGGPEKDTICELCGESHPYPVTYHMRQAHPGCGRY
AGGQGYNSIGHFCGGWAGNCGDGGIGGSTWYLVCDRCREKYLREKQTAAREKVKQSRKKP
LQVKTPRALPTMEAHQVIRANALFLLSLSSAAEPSMLCHHPPRPLHSHLLPSLKEGVSEE
LPNKMGCLYLQTLARQHTENFGAYQDDNLFQDEMRYLRSTSVPAPYISVTPDACPNVFEE
PESNMKSMPPSLETSPITDSDTAKRTVFQRSYSVVASEYDKQHSPSPARVKAVPRRRVHS
GDAEVGSSLLRHPSPELSRLISAHGSLSKGERNFQWPVLAFVIQHHDLEGLEVAMKHALR
KSACRVFAMEAFNWLLCNVIQTTSLHDILWHFVASLTPSPFEPEDEEDDENKGNKENLEQ
ERDLGVCEHPLSDIVIAGEAAHPLPHTFHRLLQTISDLMMSLPSGSSLQQMALRCWSLKF
KQSDHQFLHQSNVFHHINNILSKSDDGDSEESFNISVQSGYEAMSQDLCLVTCLKDLTSV
VDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKSITISCVKGINAVKVSVHVDNSRDI
GNKVTSVTFLCGKAIEDLCRIKQADLDSRHMGWVTSELPGGDHHVIKVELKGPENTLRVR
QVKVLGWKDGEAIKIPGQISASMAQQKNCEAETLRVFRLITSQVFGKLICGDAEPTPEQE
EKNLLSSPEGEDKVSTLAPSDADLKEHMVGIIFSRSKLTNLQKQVCAHIVQAIRMEATRV
REEWEHAISSKENANSQPSDDDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLMQDLF
SLLHTASPRVQRQVTSLLRRVLPEVTPVRLASIIGVKALPPADISDIIHSTEKGDWNKLG
ILDMFLGCIAKALTVQLKAKGTTISGAAGMTAGKGVTTVTLPMIFNSSYIRRGESHWWMK
GSTPPQIAEIIIKLVKDMAAGHLSDAWSRVTKNAIAETIIALTKMEEEHRSPVRCIATTR
LWLALASLCVLDQDHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNICGNLCTD
CDRFLHLHRRTRSHQRQVFKEEEEAIKVDLHEGCGRTKLFWLMALADSKTMKAMVEFREH
TGKPTSSSSDACRFCGTRNGTELSAVGSVCSDPDCQEYAKLACSKTHPCGHPCGGVKNED
SCLPCLHGCDKNTGCLKQDADDMCMICFTEALSAAPAIQLDCTHVFHLQCTRRVLENRWL
GPRITFGFMLCPICKNKINHSVIKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITTPG
ARFHNDPAGFAMNRYAYYVCYKCKKAYFGGEARCDAEAGQGDDYDPSELICGACSDVSRA
QMCSKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSVPKEELPHCPAGPKG
KQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF
Download sequence
Identical sequences I3JI05
ENSONIP00000008499 ENSONIP00000008499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]