SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008524 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008524
Domain Number 1 Region: 26-415
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.96e-108
Family Regulator of chromosome condensation RCC1 0.0000000000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008524   Gene: ENSONIG00000006750   Transcript: ENSONIT00000008529
Sequence length 418
Comment pep:novel scaffold:Orenil1.0:GL831244.1:542579:549483:1 gene:ENSONIG00000006750 transcript:ENSONIT00000008529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAKKTTTKRKSAAIVEDDKDSKKVKVSHRSHSKEAGQVLVLGQGDVGQLGLGEDVIERK
KPALLSLPEKIVQVTAGGMHTVCLSETGNIYTFGCNDEGALGRDTSEEGSEMIPGKVTLN
EKVVQVSAGDSHTAALTEDGSVYIWGSFRDNNGVIGLLEPMKTCALPVKVPLTEHVVKIV
SGNDHMVMVTLEGNLYTSGSAEQGQLGRVPEHFSNRGGRKGLERLLVPQMVKVKGKVHFV
DAFCGAYFTFAVSKEGHVYGFGLSNYHQLGTKSTKMCFVPVKLTCFKNSTTAWVDFSGGQ
HHTLCLDAEGQVYSLGRAEYGRLGLGEGAEEKSEPTPVMGIELAKGVACGASVSYAVTRE
GSVYAWGMGTNLQLGTGEEDDEWSPVKMTGKQLENRAVLMASSGGQHTVLLVKDKQES
Download sequence
Identical sequences I3JI30
XP_003452123.1.78416 ENSONIP00000008524 ENSONIP00000008524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]