SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008550 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008550
Domain Number 1 Region: 26-255
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-64
Family Nuclear receptor ligand-binding domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008550   Gene: ENSONIG00000006772   Transcript: ENSONIT00000008555
Sequence length 258
Comment pep:known scaffold:Orenil1.0:GL831244.1:695939:699919:1 gene:ENSONIG00000006772 transcript:ENSONIT00000008555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSACRCSTSSDRTSNPILYNILSQMDGSRLSQGNFSYNSVPHRCKCEARRTVCLKRPSE
ICKEASAVLVKTLNFMKNLPAFNQLPPNDQFALLKSCWAPLFILGLAQERVDFEVTDIPT
DSMLKKILLNRPESPEVEREQPTMAGVSKLVSCLKKFWSLDLSPKEYAYLKGTTIFNPDV
PDLKAALFVEGLQQEAQQALSKVVQLLHPGDGDRFARILLTASMLQSITPSLITELFFRP
VIGQANLLELLVDMLFCR
Download sequence
Identical sequences Q8AUM4
ENSONIP00000008550 NP_001266652.1.78416 ENSONIP00000008550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]