SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008581 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008581
Domain Number 1 Region: 149-192,386-419
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000136
Family Spermadhesin, CUB domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000008581
Domain Number - Region: 460-505
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00759
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008581   Gene: ENSONIG00000006800   Transcript: ENSONIT00000008586
Sequence length 667
Comment pep:novel scaffold:Orenil1.0:GL831244.1:758569:773907:-1 gene:ENSONIG00000006800 transcript:ENSONIT00000008586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSRPQDVFSIEIVRRINCTTESCSGHIIQTDSNSIDALRFNRTFTWNLTAAAPKAFQIDF
TKTGLKQINPSEKCPDRHTYTLQAFQSTGNVAVETFCSRFTLGRINDKKGEKLNVKYVPW
LQNLYVSGAVHANFVALARISLTLPKGTSSSELLSPDYPESFPDDDIMGWYFRVPEKHRV
DVQFLNLTQPDCVKKEVAVEYHQKGRVTSVLGLNDTQPLQKQGDFLLTLRNCEMERAPAD
SPGLTFTLKVSASSPASTVSCKVDLSKTEGLSLNISTLTPTPDCVMKINSVKKDNITVTS
SFSYHNSVFILYTRLLIWVLKEEVTAVDCSSGKCPDPVSLLVPLLPFCLPAPLSRVTWIL
RPGRHGTVKLISPTGPLKQSLPGQLCDDSVTIDVAEENGAPIGTFCRDGAIQTVHIHTNV
SVTLWSSMNAKAPRSAVLNASFENEITERYIFTVFPKRDTPELVATPAWPAGMKASSTVS
WIVSVPPKMEAQLIFTKLSQPKCSNSHTNIRVQRMGSPEEDYSRREDEMAKSELTVSESF
YLNMSNCLPERGNFSVITMISLQKSKYLLLINILSVVAALLVIFVMVLVVVCVPNRKKKK
KKLNHEVSVYNPNGINFLPGYNGPPKTHEDDDAHVYTSIDDTLVYTHLFKKGADIGIYGE
TYQPFTG
Download sequence
Identical sequences I3JI87
ENSONIP00000008581 ENSONIP00000008581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]