SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008707 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008707
Domain Number 1 Region: 357-463
Classification Level Classification E-value
Superfamily SRCR-like 8.24e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 2 Region: 584-687
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 
Domain Number 3 Region: 32-129
Classification Level Classification E-value
Superfamily SRCR-like 7.72e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00023
Further Details:      
 
Domain Number 4 Region: 468-570
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 5 Region: 130-234
Classification Level Classification E-value
Superfamily SRCR-like 1.05e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 6 Region: 231-334
Classification Level Classification E-value
Superfamily SRCR-like 6.67e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008707   Gene: ENSONIG00000006902   Transcript: ENSONIT00000008712
Sequence length 693
Comment pep:novel scaffold:Orenil1.0:GL831276.1:190421:195551:-1 gene:ENSONIG00000006902 transcript:ENSONIT00000008712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSRGIMIDVFGCNVTKCGKVQGGRILFLNGSGSTQCSGRVEVYLNNSWGTVCDDGWDLND
AEVVCRQLNCGSALEVPQSDHFGAGTGQIWLDHVTCSGNESTLAECQHSGFGSNTCEHGQ
DAAVICSDLIRLAGAGSSRCSGRVEVFHNNIWGTITDFNWDLNDAEVVCRELNCGSALQA
PQSAYFGPGTGQIWLGGVTCSGNESSLSECQHFGWAKGPIRLTGSGSTRCSGRDLIRLVG
SGSSRCSGRVEIFHNNIWGTVSDSNWVLNDAEVVCRQLNCGSALEATQSSKFGAGTGQVW
LTGVTCSGNESSLSECQHTGCGHYYDVGVICSGSCICIFLKGFIFKHSLCLVFYIKGDIR
LVGSGSTRCSGRVEVYHSNSWGTVCDDGWDLSDAEVVCRQLNCGSALEVPQSAHFGAGTG
QIWLDRVTCSGNESSLTDCQHSGFQSNRCEHGQDAAVVCSGSLPIDLIRLAGAGSSRCSG
RVEIFHNNIWGTVFDFNWDLNDAEVVCRQLNCGSALQAPQSAYFGPGTGQIWLGDVTCSG
NESSLSECQHSGWGNNGHYSDAGVICSGVKTKVCVMSFSLKGLIRLTGSGSTGCAGRLEV
YHNNSWGTVCDDGWDLSDAEVVCRQLNCGSALEVPASAHFGAGTGQIWLDNVTCSGNESS
LTECQHSGFGSNTCEHGQDAAVICSGSNSGLLS
Download sequence
Identical sequences I3JIL3
ENSONIP00000008707 ENSONIP00000008707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]