SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008765 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008765
Domain Number 1 Region: 21-197
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-50
Family SPRY domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008765   Gene: ENSONIG00000006950   Transcript: ENSONIT00000008770
Sequence length 200
Comment pep:novel scaffold:Orenil1.0:GL831624.1:149344:152019:1 gene:ENSONIG00000006950 transcript:ENSONIT00000008770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTALTPPPFRVEPAGVRWLRPGLRKYSCQLTIDTNTVHTKLKLADNNRKVTHVKEVQSY
PDHPDRFDGCHQLLCRNDLTGRCYWEVEWRGRVDISVSYRRIRRKGDSDDCLFGENDQSW
SLMCCGDSVSARHNKKETISSSSSSVSNRVAVYVDCPAGTLSFYRVSSDTLIHLHTFDTT
FTETLYPGFGLWSGSSVCLS
Download sequence
Identical sequences I3JIS1
ENSONIP00000008765 ENSONIP00000008765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]