SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009059 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009059
Domain Number 1 Region: 1538-1646
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.18e-33
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 676-780
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-33
Family Spermadhesin, CUB domain 0.00031
Further Details:      
 
Domain Number 3 Region: 840-954
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-32
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 4 Region: 2061-2169
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-31
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 5 Region: 1883-2003
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-31
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 6 Region: 20-127
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-30
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 7 Region: 2228-2346
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-29
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 8 Region: 499-610
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.68e-29
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 9 Region: 2415-2518
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-28
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 
Domain Number 10 Region: 1358-1474
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-27
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 11 Region: 1191-1300
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-26
Family Spermadhesin, CUB domain 0.00098
Further Details:      
 
Domain Number 12 Region: 197-299
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-26
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 13 Region: 1017-1127
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-25
Family Spermadhesin, CUB domain 0.00095
Further Details:      
 
Domain Number 14 Region: 1712-1821
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-24
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 15 Region: 2823-2891
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.15e-19
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 16 Region: 2766-2834
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.9e-19
Family Complement control module/SCR domain 0.00076
Further Details:      
 
Domain Number 17 Region: 3124-3196
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-18
Family Complement control module/SCR domain 0.00099
Further Details:      
 
Domain Number 18 Region: 2882-2948
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.51e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 19 Region: 3005-3073
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.22e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 20 Region: 3185-3254
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.25e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 2707-2776
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-16
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 22 Region: 3058-3120
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.17e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 23 Region: 3305-3373
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000208
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 24 Region: 2937-2998
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000278
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 25 Region: 3244-3300
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000292
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 26 Region: 436-507
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000113
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 27 Region: 2174-2243
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000243
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 28 Region: 960-1019
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000324
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 29 Region: 2002-2064
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000351
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 30 Region: 614-673
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000375
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 31 Region: 1478-1542
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000486
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 32 Region: 2519-2592
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000514
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 33 Region: 1652-1717
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000661
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 34 Region: 2653-2718
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000702
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 35 Region: 2581-2648
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000283
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 36 Region: 3364-3422
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000306
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 37 Region: 1133-1195
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000378
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 38 Region: 133-197
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000513
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 39 Region: 1828-1893
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000012
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 40 Region: 2345-2410
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000297
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 41 Region: 785-851
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000473
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 42 Region: 1304-1366
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000514
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009059   Gene: ENSONIG00000007185   Transcript: ENSONIT00000009064
Sequence length 3663
Comment pep:novel scaffold:Orenil1.0:GL831158.1:2637201:2850111:-1 gene:ENSONIG00000007185 transcript:ENSONIT00000009064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YMHWIMMFCLFSFLPGFIHSCGGTLKGRNGTIESPGFPYGYPNGANCTWVIVAEEGNRIH
IVFQSFAVEEEYDFLSLYDGHPHPANFRTRLTGFTIPPPVTSSGSIFSLRLTSDFAVSAH
GFKAAYEELRSSSCGNPGVPPKGILNGTQFNVGDKIRYRCVTGYVLDGHSLLTCVTNAAG
VSVWDFPVPICRAEDTCGGTLRGSSGLISSFDFPSGLGSSGECKWTILADPGDTISLVFT
EFQMEEKSDYLEIEGSEPPTIWLTGMNIPAPIISNKNWLRLHFVTESNHRHKGFRAQYQE
SSIQTLNNMHVANRCKRKTSIHSDKHLEVLLSSVLLGMYQFSSNQQIDSPPFFCTSIWPL
LCLIRLSLEDAEQKQLQFDVLHRTKYYPEKETLVLSRPVKSSGELKSRGVKLLPGKDNTN
KLSLMNEGGIKQVSNYCPDPGEPENGKRIGSDFSIGATAQFTCDEDHVLQGSKTITCQRV
AEVFAAWSDHRPVCKVKTCGSNLQGPSGTFTSPNFPIQYESNSQCVWIITASDPNKVIQI
NFEEFDLEIGYDSLTIGDGGEVGDSKTIIQVLTGSFVPDLIVSMSHQMWLHLQSDESVGS
IGFKINYKEIDKESCGDPGTPLYGYQEGTGFLNGDVLRFECQFGFELIGERMITCQNNNQ
WSANIPICIFPCFSNFTAPMGTVLSPDYPEGYGNNLNCVWLIISEPGSRIHLAFNDFDLE
PPYDFLTIKDGDQSGATILGRFSGAEVPSHLTSNSNVLQLEFQADHSMSGRGFNITYSTF
GHNECPDPGIPLNARRFGDSFQLGSSISVVCEDGFIKTQGADTITCHLEEGKVMWSGLIP
KCEAPCGGHYSGPSGVILSPGWPGYYKDSLSCEWVIEAELGRSIKISFDRFQTELSYDFL
EVHDGPNLLSPLIGSFNGTQVPQFLFSSSNFLYLLFTTDNSRSNSGFKIFYEVVTLDTYS
CMDPGIPVNGFRLSHDLSIGSTVTFQCDPGYRLSHEEPLVCEKNHFWSHPLPTCDASCGG
DIRGPGGIILSPGYPELYPNSLNCTWTVEVSHGKGVQFTFHSFHLEDHHDYLLITENGSF
AQPLARLTGSERPAPINAGLYGNFKAQLRFISDFSISLQGFNISFSEYDLEPCEDPGTPR
YGWHTGSKFGIGDSLSFYCNTGYRLQGAREIVCLGGGRRMWSAPLPRCVAECGSTVSNNE
GVLLSPNYPMNYDNSHECVYSIQVQTGKGINITASTFELAQGDVLKLYDGKDGAAPLLGT
YTSTLMQGLSLTSTSNYLWLEFYSDHEKTAAGFRLIYHSFELSHCDDPGVPQFGFKISDQ
GHFAGGAITFGCDQGYTLHGFGMLKCMTGERRAWDNPLPSCIAECGGSFKGESTGRILSP
GYPFPYDNNLRCTWTIEVNSGNIVSLQFLAFDTEASHDILKVWDGPPENEMSLKEVSGSL
LPEGIHSTLNIVTIQFETDFYITKSGFAIDFSSSLATACRDPGIPMNGSRNGEGREPGDS
VTFSCDPGYELQGESRITCIQVENRYYWQPSPPSCIAPCGGNVTGSSGFILSPNYPHPYP
HSKDCDWLIAVHSDYVISLAFISFSIEPNYDFLYIYDGPDSSAHLIGSFQDSKLPEKIES
TSNFMYLAFRSDGSVSYTGFHLEYKAKLREACFDPGNVMNGTRMGTDYKLGSMVTFHCEA
GYLLQGYSTLTCVMGNSKRPEWDRAKPSCQAPCGGHFTGSEGTVLSPNYPHNYTIGQTCV
YDIFVPGDFVLFGQFVVFQTLISDVVEIYDGSSADSALLSSIYGSHSGETLPLSSGNKIM
LKFTTNGTETAKGFHFVYQAVPRTSATQCSSVPEPRFGKRIGNDFGIGMAVLFECSPGYT
LHGSNAIRCEAVPNALAQWNGTVPTCVVPCGGVLTERKGTILSPGYPDPYANYLNCAWKI
SVPEGAGIQIQVVTFATEHNWDSLDFFDGVDGNAPRLGSYSGTTIPQLLNSTSNNLYLTF
QSDISVSAAGFHLEYTAIGLDSCPEPLPPSNGRKVGDRYTVGDMVSFQCDQGFSLQGNAY
ITCMPGPVRRWNYPVPLCLAQCGGSMTDFSGVILSPGFPGNYQSSLDCSWRVQLPIGFGI
HLQFLNFSTEPVHDYLEIRSGSLETGTVIDRFSGPTLPNPLFSTTHETTLFFHSDYSQNK
PGFHIVYQAYELQRCPDPRPFRNGIVIGQDYSVGMTISFECLPGYTLLGEQSLTCLHGIS
RNWNHPIPRCEALCGGNITSMNGTIYSPGHPAEYPHFQDCMWTVRVPPGYGIYINFSVIN
TEPIYDYITVWDGPDQSSPQIGQFSGSSVQEGVSTTANQVLIKFHSDFSTSGFFELHYFA
YQLRTCQPPPPVANATILTEDDEFEIGDIIRYTCQPGFTLVGSEILTCRLGERLQMDGPP
PVCQVQCPAHEVRFDSTGVILSPGYPDNYPNLQMCSWLINVEKGYNITLHFELFQTEKEF
DILEIFDGPNIYSQSLSSLSGDIETPFSLTTTGHQLLLRWSSDHGTNRRGFHIRYVAMYC
STPDSPQHGFVVSQTGGHLNSVVRWACDRGYKLIGKGTAVCKKTTYGYYAWDAPVPACQA
VSCGVPNAPANGGVLTADYSVGTRATYFCNGGYRLSKELTTTVCQPDGTWSNHNKIPRCF
VMPCPSLSPFSLDHGKWRIVNGSHYEYGTKIIFTCNPGYYRVGPAHIQCLANGVWSWRNE
RPRCRIISCGELPTPPNGKKIGTQTTFGASAIFSCNPGYVLTGSTVRECLLSGLWSGMET
QCLAGHCGVPEQIVNGQVIGENYGYRDTVVYQCNPGFRLIGSSVRICQQDHSWSGHLPVC
ISVTCGHPGSPIYGRTTGDGFNYNDVVHFSCNKGYTLEGPSTAQCQANRQWSHQPPTCRV
VNCTDPGIPANSIRESKIEHGNFTFGSVVFYDCNPGYYLFGSSVLTCQPVGQWDKPLPEC
IEVDCGHPGIPPHTVMSGEKFTFGSTVRYSCLGDRQLIGDSSLTCQLNGHWSGPLPHCSG
DSTGTCGDPGTPAHASREAGNFKVRSKVRFTCAVGHTLYGSAERICFPNGTWSGKQPFCK
SVQCGNPGTPAHGRISRLDGTTFSHSIVYSCMEGYFLTGSPTRQCLANGTWSGTAPNCTT
MAVITCGDPGIPANGLRFGDDTTVGQNVTFMCQLGYVMVGGDNAFTRTCTSNGTWSGTMP
ACQVVTCPTPPSIPNGLLEGSVLEWGTSVSYTCLPGYELSFPAVLTCTGNGTWNGDLPQC
LPKFCGDPGTPPKGRREGRSFIFKSEVTFSCSAPYVLVGSTTRMCQEDGTWSGSQPRCIE
PTRSTCENPGTPEHGFMNYSTGFKVGSRVDFQCQQGHILQGSTTRLCLPDLTWTGTQPAC
ISHSCKQPRSPANADVMGLDLPSYGYTLVYTCQPGYFLSGGSEHRVCRSDGSWTGKVPVC
RAGSKSHEKTVKHIPGTPSPKINVPDDVFAPDFIWKGSYDYKGQKQPMTLTVTSFNATTG
KVNVTLRDSSMEFLLSGVYKRQEARLMLLLYQMRAVAHSSLSRITDETWAMDGFVSAEPE
GGSYVFQGFIQSKDYGQFGLQRLGLSVRENVTLTDPETNGSTNSSSVAVAILVPFFALIF
AGLGFYLYKQRKTDKAQYTGCSVHENNNGQATFENPMYNTNTKAAEGKVVRFDPNLNTIC
TMV
Download sequence
Identical sequences I3JJL5
ENSONIP00000009059 ENSONIP00000009059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]