SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009166 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009166
Domain Number 1 Region: 145-405
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.46e-84
Family Eukaryotic proteases 0.00000141
Further Details:      
 
Domain Number 2 Region: 51-155
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000968
Family Hepsin, N-terminal domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009166   Gene: ENSONIG00000007268   Transcript: ENSONIT00000009171
Sequence length 418
Comment pep:novel scaffold:Orenil1.0:GL831158.1:3929561:3934081:-1 gene:ENSONIG00000007268 transcript:ENSONIT00000009171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCAGSRGISLTCVLTPCRVIGVCVTLMTLGAIGAAVWAVVTYCTMEEDIEQYDVQVNSPD
QHLRVFDSTHRRWRQVCSSPADELLASISCEEVGFVSVVNYSVTAVSEASGDAGDFFCVR
QEELSYGKKIKDSLYPCDCESREVLTLLCQDCGRRSFAADRIVGGVDARHGSWPWQVSLQ
YDGVHQCGGSIISDRWIVSAAHCFPERYRFVNRWRVLLGSIYNKPVNANVAEVKTIVYHS
SYLPFVDANIDDNSRDIAVLALTQPLTFNEYIQPVCLPAYGQRLIDGQMGTVTGWGNVGY
YGHLADVLQEANVPIISDAVCNAPDYYDNQITTSMFCAGYEKGGTDACQGDSGGPFVAED
CLSKTTRYRLLGVVSWGTGCAMSKKPGVYTRVSRFLPWISSAMRKDFSEASGRHIPDL
Download sequence
Identical sequences I3JJX2
ENSONIP00000009166 ENSONIP00000009166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]