SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009262 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009262
Domain Number 1 Region: 12-193
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-53
Family SPRY domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009262   Gene: ENSONIG00000007342   Transcript: ENSONIT00000009267
Sequence length 194
Comment pep:novel scaffold:Orenil1.0:AERX01073979.2:21:3374:1 gene:ENSONIG00000007342 transcript:ENSONIT00000009267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DQSTEQVLRFALQKYFCELELDPNTAHRNLKLSDNNRRVTHVRAVQPYPDHPDRFEYWNQ
LLCKHELTGRCYWEIEWRGVVDVAVTYGQIRRRGDGDDCKLGSNDQSWSLNCCEDGYRAC
HNNFRKDVDLALPSSSSVSNRVAVYVDCPAGTLSFYRVSSDKLVHLHTFNTTFTEPLYPG
FEVWYGSSVSLCSV
Download sequence
Identical sequences I3JK68
ENSONIP00000009262 ENSONIP00000009262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]