SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009506 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009506
Domain Number 1 Region: 284-395
Classification Level Classification E-value
Superfamily TPR-like 9.38e-29
Family Tetratricopeptide repeat (TPR) 0.0015
Further Details:      
 
Domain Number 2 Region: 515-594
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.91e-18
Family Canonical RBD 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000009506
Domain Number - Region: 390-427
Classification Level Classification E-value
Superfamily UBA-like 0.00067
Family UBA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009506   Gene: ENSONIG00000007538   Transcript: ENSONIT00000009512
Sequence length 628
Comment pep:novel scaffold:Orenil1.0:GL831221.1:154762:165410:1 gene:ENSONIG00000007538 transcript:ENSONIT00000009512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIYREEEEIPDPHMFRTVLGMFEGRPHMQRIIRCGLLGIDYDDDLDDPGNDDYVSWSHD
FHGYPTNRLRSSSTVYQPVYSSARNSSCPSPLRFQTKERDAERKARLLEESKKSKEKAEK
KRLKKRKQKERKRLEKLEKDKLNPEKNEEGKDDAEQSKAEEGKAANDEHKANNNTSVKPQ
ASAKDTDSSDSSDVSSDEDGNSKNDSGDSEELDMTSSFVRKAALIAMHKLEQKPRPEKKE
KKKMPEKEEYKTVPEKSNKEREVAKKDSAAPSVPSFEDHVKKSTELAVIGNKHASAGDFN
MAVKYFTDAIKHNPKEFKLFGNRSFCFEKLQEYEKALMDAELSLGICPGWDKGLYRKGRA
LAGLKRYEEAAQAFTEVFKLDSSCAEAAQELMRVQITQLMEFGFTREQSSNALIIHGTVK
KALEVLSKLNDRPGALPNGSLPPVQVANVTGVSPILSANTIAAPAAAACPPAQSKDALKK
PLMNKPLGAVQNTSAAQSQSKPILTQPMKASNGVNRPPLELFPVWVGNLNFPVTDSMLAN
LFNKVGVVYSVKVLTAKRCAFVNFTKQEHCDEAIRRFHGFELNHNKLAVRYPDRIPAGLG
ISRSALRADDLQDENARHNENSQRTVRP
Download sequence
Identical sequences I3JKW2
ENSONIP00000009506 ENSONIP00000009506 XP_003450380.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]