SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009521 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009521
Domain Number 1 Region: 47-94
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 9.42e-18
Family Cysteine-rich DNA binding domain, (DM domain) 0.0003
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000009521
Domain Number - Region: 243-288
Classification Level Classification E-value
Superfamily UBA-like 0.000173
Family CUE domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009521   Gene: ENSONIG00000007550   Transcript: ENSONIT00000009527
Sequence length 409
Comment pep:novel scaffold:Orenil1.0:GL831221.1:320893:322287:1 gene:ENSONIG00000007550 transcript:ENSONIT00000009527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENRIRPLGLTDHTSGPLGSLPVPPSLLRPPPLFLQACNPTLERGYPRTPKCARCRNHGV
VSALKGHKRFCRWRDCVCAKCTLIAERQRVMAAQVALRRQQAQEESEARDLRLLYPCTGI
GGEAGIPQGSSISAGVPVSVSSSPAAACFDVFGSENQKDVSEDKLSKYNFYNGFMGRPLF
APHSPRLPSPSDKKELSPSKDSGRSQSPAMDHRSDHTESPQRSLPSSDPESGSESEKPNE
YLSPDRDPTDIMAKIFPHQKRDTLESMVRTCKGDIVKSIELALNSKENKIDADSARRPSA
GLPGGLGALGAKSAFSPLHIPASPGGDSLYGLSSRLGVSPLRLAYPSANGGMAGFMSPYM
TSGLMPVFPLRPPLDSYSLPGMIRDLSYIQSKESLCNAGLYTRLNSETK
Download sequence
Identical sequences I3JKX7
ENSONIP00000009521 ENSONIP00000009521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]