SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009605 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009605
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily Cupredoxins 2.19e-45
Family Ephrin ectodomain 0.00000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009605   Gene: ENSONIG00000007621   Transcript: ENSONIT00000009611
Sequence length 183
Comment pep:novel scaffold:Orenil1.0:GL831201.1:1568237:1575376:-1 gene:ENSONIG00000007621 transcript:ENSONIT00000009611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFFQGDYTVEVAINDYLDIYCPHYEAAESAVHMEHYVLYMVNYDGYMSCDHHRKGFKRWE
CNRPQSPNGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISSPHPNLGRKPCLKLKIYVKPT
KLVQVTLGCLDRPHPHPDVENWMDGDDSVYDSAEPFLTDDTTGGCSLALPSAMLLTLLLI
LLI
Download sequence
Identical sequences I3JL61
ENSONIP00000009605 ENSONIP00000009605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]