SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009669 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009669
Domain Number 1 Region: 3-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.53e-22
Family Ubiquitin-related 0.0000299
Further Details:      
 
Domain Number 2 Region: 293-357
Classification Level Classification E-value
Superfamily XPC-binding domain 4.05e-22
Family XPC-binding domain 0.0000541
Further Details:      
 
Domain Number 3 Region: 361-419
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000296
Family UBA domain 0.00044
Further Details:      
 
Domain Number 4 Region: 188-245
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000323
Family UBA domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009669   Gene: ENSONIG00000007671   Transcript: ENSONIT00000009675
Sequence length 421
Comment pep:novel scaffold:Orenil1.0:GL831201.1:1944138:1966763:1 gene:ENSONIG00000007671 transcript:ENSONIT00000009675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTITLKTLQQQTFRIEIDPELTVKALKEKIEEHRGKDAFPSVGQKLIYAGKILNDDIPL
KEYKIDEKNFVVVMVTKPKPTSPAEAATHSVPTPAATPVPPPAAAPAPASGPKQVPSTPT
HTTSAAVPASQSVPPSEAPPSVQENTTVASVGDSPTPAAQTEEELREDPENEPSDTAPVQ
SSASSLVDELGLLEEAASILVTGPEYENLVSEIMSIGYEREQVVAALRASYNNPDRAVEY
LLMGIPARASDLHNPQPSRHSTPANPSTPSTEEPPQQPPAPPSTAGGGSGSIGNPLEFLR
NQPQFQQMRQIIQQNPALLPALLQQLGRDNPQLLQQITEHQERFVQMLNEPQAGDTGGED
ADAHGSPHTNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQTWDD
E
Download sequence
Identical sequences I3JLC5
ENSONIP00000009669 ENSONIP00000009669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]