SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009675 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009675
Domain Number 1 Region: 370-595
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.11e-53
Family Regulator of chromosome condensation RCC1 0.013
Further Details:      
 
Domain Number 2 Region: 577-757
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.14e-45
Family Regulator of chromosome condensation RCC1 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009675   Gene: ENSONIG00000007675   Transcript: ENSONIT00000009681
Sequence length 1218
Comment pep:novel scaffold:Orenil1.0:GL831236.1:1704168:1716626:1 gene:ENSONIG00000007675 transcript:ENSONIT00000009681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPCQTHVLLKWQEHFNSSWAAEDSLQTARRHGAATLYDKLLHNKEVVTLAQPVQELAGP
RLPDFECESSASAEKEEYLSSLLRSQRWLAHRVLTQTSYTLGLHHRLVVLQRIYYALHSK
YHDKFRVQLPSHSKDSGTECGQIEPASETFLPGGASKIKSGTDVLIEMGVRTGLSLLFSL
LQQNWRYAASIHPESVLCNDVLNTASSVLTSLPPLSLANENKIPSVGLDCLAQVADFLKK
TSVSSGNGGADPTGRRLALELLLGLAMQRGSLKFLLEWVEVALAASMSSSTPTLSSSSSS
SLSSQQSAGVGFDVIHQTLLQMRQYSGFRGDPVNTQVLKKDADGHCRLSQAALCLFEEIC
NLASYCLCSCSTDAAAPGTESNTVMVYVWGSNSSHQLAEGTLEKILLPKLTQGFSDAQMI
EAGQYCTFSVSADGSVKACGKGSYGRLGLGDSNNQSMPKKLVLEPHRNIKKVSSSKGSDG
HTLAITVEGEVFSWGDGEYGKLGHGNSATQKYPKIIQGPLLGKVVVCVSAGYRHSAAVTN
DGELYTWGEGDFGRLGQSDSQSRNMPTLVKDISGVGQVACGSSHTIAVAQDGRTVWSFGG
GDNGKLGHGDTNRVYRPKVVESLHGFIIRKVCAGSQSSLALTSAGQVFAWGCGSCLGCGS
SETTALRPRLIEDLSITKIIDISCGDSHCLALSHENEVYAWGNNTMGQCGQGHTSTPISK
PKKVLGLEGVSIQQITAGTSHSLAWTAVPTDRQLVAWHRPFCVDLEESTFTYLRNFLESY
CDGISNDTPPAPFVCKRDHHHFILLCMKLLSIHLSLAHAGGTGAMVLGAQGRPLRNLLFR
LIDTDMPDSIQQAVLNTLSIGASLLLPPLRERTELLLSLLPQGPQSLNVLSKGQRLQLDM
VLSSLQDQSHVASLLGYSNFGEVTALGPPVTPLSVRQPSSSSSVDACDPLHLAEVLLRTL
LLSIGFYTEQQFGELEKNSDKQLVGDSRGQMDPPSHFHQLLSGLHKHLLAHCYISSSPED
DSSVALLREHLYLLLPCATETLRRSTKLLKEIAPDKQIIKKLQVVLYNSVSGSLLCQVMY
SLLLLPLGTVQPLLSHLLGLLEQLNDFNRLLPETVLLEEQELGVKDQKTCSDKSEENTSI
GPQEEEECRWAWLLDLERSVALAVGRCLGGMLQGSPLSLQEKASEVWLSNVLFRNGLEMD
FEQLDSSMTWLTEVVLLG
Download sequence
Identical sequences I3JLD1
ENSONIP00000009675 ENSONIP00000009675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]