SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009720 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009720
Domain Number 1 Region: 55-310
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-97
Family Protein kinases, catalytic subunit 0.00000916
Further Details:      
 
Domain Number 2 Region: 682-796
Classification Level Classification E-value
Superfamily KA1-like 9.16e-26
Family Kinase associated domain 1, KA1 0.0013
Further Details:      
 
Domain Number 3 Region: 321-374
Classification Level Classification E-value
Superfamily UBA-like 0.0000961
Family UBA domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009720   Gene: ENSONIG00000007711   Transcript: ENSONIT00000009726
Sequence length 796
Comment pep:novel scaffold:Orenil1.0:GL831340.1:612427:642279:1 gene:ENSONIG00000007711 transcript:ENSONIT00000009726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFSQSPKKSVSDRILFSHTSLSASRSEKGTGWSSRSLGARCRNSIALCSDEQPHIGNYRL
LKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKVFREVRIMKTLNHPNIVQL
FEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVHYCHQKNIVHRD
LKAENLLLDADSNIKIADFGFSNEFMAGNKLDTFCGSPPYAAPELFQGKKYDGPEVDIWS
LGVILYTLVSGSLPFDGQNLKELRERVLRGKYRVPFYMSTDCEGILRRFLVLNPTKRCSL
EQIMKDKWINIGYDGDELKPHMEPVEDFNDTSRIDVMIGMGFTREEIRDALANRKYNELT
ATYLLLGRKTETEVADSRSSSTLSLARIRPGTITNGTSAQSSSSGHKAQRSASTYHRQRR
HSDFCGPAVPGSTHPKRSPSGVAEGAGLREERLSIRKPSTNTVGSRSIPTPSSPMVSSAH
NPNKAEIPDRRKEVNSTTNNIPASAMTRRNTYVCTDRSNSDRHALLQNGKENSLTHLMAL
SHLNPVCGCYLERYEKQPQATSQPESQGWRAHYISPVDVKSNRTNNYFLKCLKVNIAGAS
GTSSSSSTPSSRLSRGSTVRSTFHGGQIRDRRPPSHAPPASPTLSHDASPLPHARTRGTT
NLLSKITSKLTRRLPCWREGSHQSNTRHLSGHQKAAEPRTPRCGWDVRVRSPRDPAEVVL
ALREAAQGCGCQVHLAGPFLLSCTHGAAGARVAFEAEVCQLPSGLGQSSGVKFKRLWGAP
LAFRDIATKVSKELEL
Download sequence
Identical sequences I3JLH6
ENSONIP00000009720 ENSONIP00000009720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]