SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010165 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000010165
Domain Number - Region: 66-177
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0732
Family HBL-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010165   Gene: ENSONIG00000008071   Transcript: ENSONIT00000010174
Sequence length 317
Comment pep:novel scaffold:Orenil1.0:GL831452.1:459981:470355:-1 gene:ENSONIG00000008071 transcript:ENSONIT00000010174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSTSQQVALAFTGVLFMFVVLPRLYGFGSGTAAKDAKLDSRYSRKGPARGQPINMNGA
GQSPENLQQMKKRVEQELKSDKYKSSSNKGYVFTLMPLYAIGVGVFAAYKFLKIRSTDDK
AQKDKFAKGAKKSMEAENQLNELEQRLAQTERMLNSILTQLDPLTNCVKSVAQEQKNEIM
SQLQTIRYLMKKRGMDCPPLHATNGERNLDDLIESLGAGDTSDKQPSSEKAEPTARVYEK
HSDIKHEAEGEETKEVRAEEYDGDATVEECDREEEEEEGGWEHSELIPSLEASHETNAEE
IGAEQLVSGLRRRNRPE
Download sequence
Identical sequences I3JMS1
ENSONIP00000010165 ENSONIP00000010165 XP_003458725.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]