SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010395 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010395
Domain Number 1 Region: 31-412
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.05e-84
Family Regulator of chromosome condensation RCC1 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010395   Gene: ENSONIG00000008259   Transcript: ENSONIT00000010404
Sequence length 425
Comment pep:novel scaffold:Orenil1.0:GL831160.1:246430:254733:1 gene:ENSONIG00000008259 transcript:ENSONIT00000010404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSAFATVSQSILECLAQILMETHARLEFCLHSWGANSYGQLSQGHVEDQASPRLSNIAA
LQNRPVRAISGGGGHSVVITESGEVFVCGQNNRGQLGLGHSADISTLQHCPILNQRVTDI
ACGWDFTLLLTDGGQLLACGSNVFGQLGVGQTVTHSADLLVVESLMEPVVSVAAGLRHSL
AVTGSGCVYQWGTGLFSYAKRALSPHAVPSHFNSKVPCLVPGLDQRISHRVTAGSAHCVC
LTGDGDLFLWGSNKHGQLTTTESFLSSPTLLKRSLLDGEKVINVWSGWTHIVAQTESGRV
FTWGRGNYGQLGRQISASEDTEQQPAGPVAQGGTQEVGLPAEVENLRGATQICCGSEHNL
ASVGGSLLSWGWNEHGMCGDGSQANVFLPQLVPGLRPVLIGCGAGHSMAVCAATTGTETN
SAPLE
Download sequence
Identical sequences I3JNF1
XP_005450873.1.78416 ENSONIP00000010395 ENSONIP00000010395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]