SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010461 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010461
Domain Number 1 Region: 50-174
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.57e-21
Family Synaptotagmin-like (S variant) 0.041
Further Details:      
 
Domain Number 2 Region: 223-272
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000128
Family CUE domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010461   Gene: ENSONIG00000008316   Transcript: ENSONIT00000010470
Sequence length 275
Comment pep:novel scaffold:Orenil1.0:GL831670.1:186629:202315:-1 gene:ENSONIG00000008316 transcript:ENSONIT00000010470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTISTQRGQVYIGELPQDFLRITPTQQQQQVQLDAQAARQLQYGGSISTVGRLSITVV
QAKLAKNYGMTRMDPYCRIRLGYAVYETPTAHNGAKNPRWNKVIQCTVPPGVDSFYLEIF
DERAFSMDDRIAWTHVTIPEGLREGRVVDEWFSLSGRQGDDKEGMINLVMSFTSLPAGVM
TQPVVFMPSVYQQGVGYVPITGVPAVYNQGMMPMAVPTTMPAIGNQGLPCTEQDLKALQD
MFPNLDKEVVRTVLDAQQGNKDAAINSLLQMAEEL
Download sequence
Identical sequences I3JNL7
ENSONIP00000010461 XP_003459909.1.78416 ENSONIP00000010461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]