SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010465 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010465
Domain Number 1 Region: 278-384
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-23
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 2 Region: 97-208
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.29e-21
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 3 Region: 390-448
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000128
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 450-513
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000105
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 5 Region: 37-100
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000021
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 6 Region: 518-578
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000223
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 7 Region: 213-277
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000011
Family Complement control module/SCR domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010465   Gene: ENSONIG00000008319   Transcript: ENSONIT00000010474
Sequence length 672
Comment pep:novel scaffold:Orenil1.0:GL831509.1:59983:211886:1 gene:ENSONIG00000008319 transcript:ENSONIT00000010474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLVVRSHSNQISIRFHSINPQAGAVLVRYQAFVLSCVFPKQPLYGDVSVSSLHSGGQA
FFSCLTGYKLQGSSVLTCRNSSTPYWSGKEPKCLAACGGLVRNITVGRIVSPGFPSNYSN
NLTCHWLLEAPEGQRLHIHFEKVALAEDDDRLLIKNGNSINAAVLYDSYEVEYLPNEGLL
STSRQLFIELTTDATGTSTGIAIRYQAFAAGHCYEPFVKYGNMTSTDNTWSVGAVVEFAC
DPGYTLEQGSVTIECMDPNNPQWNETEPACRAVCSGEITDSAGVVLSPNWPESYDKGQDC
IWGIHVEEDKRIMLDIQVLNIGKNDLLTFYDGDDLTAKLLGQYGGSKSRFKLYTSTADVT
IQFQSDPATNVYGYGNGFVVHFFEVARNDTCPELPEISNGWKSTSHPELVQGTVVTYQCY
PGYQVVGSELLMCQWDLTWSGDLPSCERVVSCADPGKVEHSRRVLSGTHFTIGSTIQYIC
DKGFTLSGNSLLTCFSRGSSGPRWSQKLPRCLPETFEPCNHPGTPTYGMPSSNKLHFQAG
ETLHYSCQTGHQLLGEPLLYCVPGHPSQWSGLPPVCKAIFVKILSSRPILISTVSTADLR
MEGAQVALAVFISITFFLILIIGLYLYFSKFQRKPLRLTLYSNLPYENITGESTLYNSVY
ETMESREYEVSI
Download sequence
Identical sequences I3JNM1
ENSONIP00000010465 ENSONIP00000010465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]