SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010816 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010816
Domain Number 1 Region: 886-916
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000077
Family A20-like zinc finger 0.019
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000010816
Domain Number - Region: 4-41
Classification Level Classification E-value
Superfamily UBA-like 0.0011
Family TAP-C domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010816   Gene: ENSONIG00000008603   Transcript: ENSONIT00000010825
Sequence length 920
Comment pep:novel scaffold:Orenil1.0:GL831154.1:4352003:4399329:-1 gene:ENSONIG00000008603 transcript:ENSONIT00000010825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVDMDAVLSDFVRSTGAEPGLARDLLEGKNWDFTAALSDFEQLRQVHAGNLSYSFTEER
TYLPPEKEMARVGRPILHRQDEVVQATEKRLSRGISHASSTIVSLARSHVSSTGGSSNEP
LLDTPLCTFQLPDLTVYRDDFRSFIERDLIEQSMMVALEHAGRLNWWTKVVSNCQSLLPL
ATSGDGNCLLHAASLGMWGFHDRDLMLRKSLYALMDHGLEREALKRRWRWQQTQQNKESG
LVYTEEEWQKEWNELLKLASSEPRIHYSTNGTNGAESSDEPVYESLEEFHVFVLAHVLRR
PIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPAAKCHRSPLVLAYDQAHFSALVSMEQK
DSSKEQVVIPLTDSEHKMLPLHFAVDPGKDWEWGKDDTDNVMLASVALSLEAKLQMLHSY
MTVTWLPLPCEQAPLAQPESPTASAGEDARSPPDSGESDKESVSSSSNGNGDTTTGSTVN
GGGSLAKNSSSSSSSSSSSGSAGKDKTKKEKDKDKDKKRADSVANKLGSFGKSLGSKFKK
NVGGLMPGKNVGAGGAKQEGGEKKKGSFRGRKGSKDSSPSAHASEDSGKGSPSSGSERLN
GAGSSMSSSGGSSTESEPYKYSADVKVSLGILRAAMQGERKFIFASLLTTSNRQPFQEEM
IQRYLTDAEERFRAEQEQQRREAERKSIANSLQPPKKEVVGCSELSYRPYEPKEELSENS
SPSFNTLKLSPLSPSMYSAVVPIPRPSFIDQPLPAASLTQHLHMHGYVDNRRQLAGGSSA
ISYPGLPSYATLPRHGPTAQPPSHPQYNNSQGPSSLSPSRLAPSYPPEFDPPDYPGAELT
TGNYTNGFRDMSSNLDSRNGQPPVRHYSLGSASGLAGLQSSRCRTPNCNYYGHPETGNYC
SYCYREELKKRETEPAIHRF
Download sequence
Identical sequences I3JPM2
ENSONIP00000010816 ENSONIP00000010816 XP_013123849.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]