SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011349 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011349
Domain Number 1 Region: 11-115
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.28e-30
Family Spermadhesin, CUB domain 0.00016
Further Details:      
 
Domain Number 2 Region: 131-253
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-17
Family Spermadhesin, CUB domain 0.005
Further Details:      
 
Domain Number 3 Region: 252-288
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011349   Gene: ENSONIG00000009024   Transcript: ENSONIT00000011358
Sequence length 490
Comment pep:novel scaffold:Orenil1.0:GL831332.1:21732:33912:1 gene:ENSONIG00000009024 transcript:ENSONIT00000011358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECGTWVKEPDGGYFTSPNYPEKYPPERECIYIIEASPRQCIDLFFDEKYSIEPSWECKFD
HIEVRDGPFGFSPIIGRYCGQESPSYVRSSGRYLYIKFVADSELEAIGFSARYNFTKDPE
FKELGELPALPFCEFEMNGPEGYVDSTQIAKEGRAQQTEAVDCRWYIRAPPRAKIYMRFL
EYEMHNSNECKRNFVGIYDGSSSVEHLKNKFCSTVANDVMLVTSVGVVRLWADEGSRKSR
FKILFTTFHEPPCERDTFFCHSNMCINHTLVCNGIQNCVYPWDENHCKEKRKPSILDTLD
NTNLTIIGVTCGLVVILLIISVIIQVKQPRKKYIIRRDDFDPALLHPGFEPPHYELCTLR
RAPSGDLTDPALAEDFDKFHKLRRSESKCIRDHHCGSHQGSVHGSRSNLSVRDATIVPDG
GALVSQLQPVMVNQQSPRLSHHNTPTSRRNIVVMKHSYSQDAAGGYRAEEEEDLMMDDGP
TTSQHHMYHH
Download sequence
Identical sequences I3JR55
ENSONIP00000011349 ENSONIP00000011349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]