SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011561 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011561
Domain Number 1 Region: 562-705
Classification Level Classification E-value
Superfamily C-type lectin-like 6.58e-40
Family C-type lectin domain 0.00028
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000011561
Domain Number - Region: 44-247
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.000602
Family HBL-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011561   Gene: ENSONIG00000009194   Transcript: ENSONIT00000011570
Sequence length 705
Comment pep:novel scaffold:Orenil1.0:GL831134.1:755735:762093:-1 gene:ENSONIG00000009194 transcript:ENSONIT00000011570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GIQEGTECTKCKNDWALRAAIALLYVLCALLTIAVAVLGYKVVEKMDNMTEGMQNYGGKI
NAVETDLKKLDDQAGMMSVNAISEMKTFKSDLEALQNQLQRIADRATSNSDRLDELRITG
GDTESGHVSLQSFMENNDASLRGIKQTLTSYSGMIDSLEADTARLQSEIQSQVKVQSQTQ
VDVSALNITQAQQRNLLSTLQKTIENAGQEVQKLKNDYQILQQTARQTRADTEWLKEKVQ
NLQVLAANNSALARSNEEALNDLGAQLSTLASQIQNTSALTEEHDQSLREMMDHQRDHDN
ATSFKFDKMEARLDRHENDMNRVTGNISFAAQILGVISSELNGLRSCAETVMQHSDLLVG
LNESVTQANADNRELRAQQDELTARLDREVNNLSMVMEEMKLVDSKHTQLITNFTILQGP
PGPRGPRGDRGPQGPMGQTGQKGDKGDKGMPGLVGTKGEQGAAGPPGAAGPKGSVGARGV
VGPKGSRGSSGRPGNPGEKGDPGVPGPPGRDGPSGMPGPPGPQGPRGVAGPSGMEGPRGS
VGPMGPPGPPGLPGLPGTPIIVKPPQPTQPRPVPQPPSCPREFRNFGDSCYYFSSGSQRL
NFDEANRFCTNRSAHMLIINNNEEQQFVKKAITGKGYFWLGLSDREEENVWKWVDGTIPV
FTKWKPGQPDNWKHGHEDGEDCAGLIHEANWNDFYCTDRIGFICE
Download sequence
Identical sequences I3JRR6
ENSONIP00000011561 ENSONIP00000011561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]