SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011840 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011840
Domain Number 1 Region: 9-49
Classification Level Classification E-value
Superfamily UBA-like 0.000000199
Family TAP-C domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011840   Gene: ENSONIG00000009420   Transcript: ENSONIT00000011849
Sequence length 176
Comment pep:novel scaffold:Orenil1.0:GL831151.1:2147709:2159667:1 gene:ENSONIG00000009420 transcript:ENSONIT00000011849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVNMEELRHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSSFFQEANVPGHHHQMM
CTPRNTPATPPNFPDAITMFSKLRASECGSGTGSGPSQVSMACSPPAHSSTVGFGSFWAS
SPPSHQPAWLPPSSPTGHHMHHNHYHHMQQTPMWPPVSQPNGSQQAPVVSALHGQR
Download sequence
Identical sequences I3JSJ5
XP_003442616.1.78416 ENSONIP00000011840 ENSONIP00000011840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]