SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011847 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000011847
Domain Number - Region: 70-151
Classification Level Classification E-value
Superfamily Cupredoxins 0.0438
Family Plastocyanin/azurin-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011847   Gene: ENSONIG00000009426   Transcript: ENSONIT00000011856
Sequence length 226
Comment pep:novel scaffold:Orenil1.0:AERX01074579.2:27:2347:1 gene:ENSONIG00000009426 transcript:ENSONIT00000011856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAIAALLLMLNYLSVSHGGICMEGPQQFPAVQIDAGQGKVVMTDSNNYAYFLIGSQWYK
MGLLTLKHVSVGPAGIWGVDLNNRVYEYVAGSFVFANGESLRQVDAGGDGQVVGVTDTST
IHCLQSTIASVYREQSTLSWITLPGLLMYVSCSTKYGCWGVNSAENIYFTKVTPSTCGIS
DWIHVDGLAVKVETGTDGSVFVVNRVGEVYQRQGIDSRTPQGTSWT
Download sequence
Identical sequences I3JSK2
ENSONIP00000011847 ENSONIP00000011847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]