SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011885 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011885
Domain Number 1 Region: 54-181
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 4.84e-56
Family N-terminal domain of cbl (N-cbl) 0.000000373
Further Details:      
 
Domain Number 2 Region: 268-354
Classification Level Classification E-value
Superfamily SH2 domain 1.34e-47
Family SH2 domain 0.0000029
Further Details:      
 
Domain Number 3 Region: 360-438
Classification Level Classification E-value
Superfamily RING/U-box 9.36e-42
Family RING finger domain, C3HC4 0.00000964
Further Details:      
 
Domain Number 4 Region: 183-267
Classification Level Classification E-value
Superfamily EF-hand 5.1e-38
Family EF-hand modules in multidomain proteins 0.00000793
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000011885
Domain Number - Region: 844-878
Classification Level Classification E-value
Superfamily UBA-like 0.000894
Family UBA domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011885   Gene: ENSONIG00000009458   Transcript: ENSONIT00000011894
Sequence length 890
Comment pep:novel scaffold:Orenil1.0:GL831273.1:123469:138861:-1 gene:ENSONIG00000009458 transcript:ENSONIT00000011894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVVSHPPPAQPRANPRSPTELMAGNPRRGAGLIGLMKDAFQPHQQALQPHQPAVVDKKMV
EKCWKLMDKVVRLCQNPKVALKNSPPYILDLLPDTYQHLRTILSRYEGKMEILGENEYFR
VVIDNLTNKTKQTMSLFKEAKERMYEENSQPRRNLTKLSLIFSHMLAELKAIFPNGLFQG
DNFRITKADAAEFWRRSFGDKTIVPWRTFRQALHEFHPISSGLEAMALKSTIDLTCNDYI
SVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLHRFIHKPGSYIFRLS
CTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGYREGFYLFPDGRAQNPDLTGLCEPS
PQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCRHLMCTSCLTAWQESEGQGC
PFCRCEIKGTEPIVVDPFHPKASGASFAGFQGSSRAEAAGNEEEEDDRLEDQQLVMSRLA
CTKVERPPSPVSQLPPVPPRLDLLQQRSSASHSALSQGATAKTQMVATHRDKPLPLPPAL
RELPPPPPPERPSLVGQESRLQRRPLPSTPDQPAWAANYMVPRPATKAPLAPSSIPQSNG
AGAEGSKPQTAINAVYCLAARYGALLQSLPGSAVSSGEKLSSDGEDNEYMSPTSLPASGA
PWVITGSLVPPPPTQGNNHNDISKISDYELIANKPCKPAVCKGHPIRRKLTLRGRWPESI
NKDPQVYESMCNIQAQAGSSETTQTSEDHPQHSAVPQDKKEEASVEDVYEYDFPRSVVPP
APARRALSDIGGPSAAFSNLSIDSAVDPSMFVAGVDPERPPKPLPRRANSDRRPRPGSLA
LNGEIECLISQGYSIQDIQKALMIAQNNLETAKNILREFVSIPSTAHIAT
Download sequence
Identical sequences I3JSP0
ENSONIP00000011885 ENSONIP00000011885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]