SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011906 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011906
Domain Number 1 Region: 152-431,520-638
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.35e-74
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0023
Further Details:      
 
Domain Number 2 Region: 6-67
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000153
Family UBA domain 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000011906
Domain Number - Region: 1027-1060
Classification Level Classification E-value
Superfamily TPR-like 0.0696
Family Tetratricopeptide repeat (TPR) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011906   Gene: ENSONIG00000009476   Transcript: ENSONIT00000011915
Sequence length 1209
Comment pep:novel scaffold:Orenil1.0:GL831273.1:185303:209886:-1 gene:ENSONIG00000009476 transcript:ENSONIT00000011915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSSAMRADQSENGENSTNSQSEMLISQLREITGIQDQQILYRALNVSQGDIGHAVGLLT
TQTAELQDPGEPQESGTSGEAWEGQKGLPKDELQTAIELSLQESHKAQEEEREFHRALEA
SAEENAARIKRKRCEAQSEMCSPAEWIRQDDWPVGIRNVGNTCWFSAVIQSLFHLPVFRR
LVLNYHLSEKILEKCKSHSDKRNIAFMQELRCLFALMVGSTRRFVDPSAAVELLRDAFRT
NEAQQDVSEFSHKLLDWLEDAFQLAASGKNAEDKQHNPMVQLFYGTFVTERRHEGKTVYN
IEQFGQYPLQVNGFNNLDECLEGAMVEKEIESVHSEHHVTSGRERWFKKLPPVLTFELSR
FEFNTQLGRPEKIHKKLEFPQIIYMDRYLHKNIEQTHERRGEVKKLKEQLAVLQQKLECY
KNYGSGPTKYPLADMLQFVLEFATTKPTSVSPAEDSRQAASSPTPPSAPLSEAIAKESSD
PGESVSSESLGSSVSSCQRTPIYKPFTQCRQPIDCPPHPAPHSITEEELHFAKTCLQRWR
TEVENDINELKASIDRLTQTLEGMYSDNSLCQAPYRLHAVLVHEGQASAGHYWAYIYDHT
NQRWLKYNDISVTESSWDELERDSFGGMTNASAYCLMYIDDRLPQLITEDTDDETGQVLH
GMDSLPPILRRYVHEDNRWFQQELSEWEEQFCQTATPQEESTASAEPTSPSLDNIQQSPV
EPAPQSGPSTEEVDEGVAPEPQPDPEAEKEPEPDLRKEPEAQTDLSPPPPEGPGCQPGDT
STPTVTDTTGVSQSSDSDEKELQNQIPGPDVELCNQTPSDIHIEKDDPEVAGLVSEAEEE
PQASGEAPEPIAEQSSEEQQQQQEVPARPRQTENEVSEVEIPNVGRIMVRADADGYNEEM
MLTPAMQGVILAIAKARQIFDKEGPEAGLIKAFHEEYSRLYELSQEETTPQEDARLQHAL
VYFFQNKAPKRVIERTLLEQFTDRNLSFDERAISIMREARAKLRLIKPEDMDMEEYMQWH
DDYRLFRTVFVYLLTGLEHYQHGKMREALNYLAHAYETNATLLRNGEKRGVDKSLIAVYR
RKCLTALNENASQLFCSGEEAKVEEGITIMDEAVIPCLHLMSRDSTLPQEDRDAMEAIRS
HWCCCLGRDMDHSLQVKLGELLPRVLDGSADTVVLKDPPKVHVTQAYDLCSRLAAVMESI
HNTSVVIVK
Download sequence
Identical sequences I3JSR1
ENSONIP00000011906 XP_019219254.1.78416 ENSONIP00000011906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]