SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012035 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012035
Domain Number 1 Region: 101-234
Classification Level Classification E-value
Superfamily TNF-like 2.17e-31
Family TNF-like 0.00031
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000012035
Domain Number - Region: 45-121
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0366
Family Hemolysin E (HlyE, ClyA, SheA) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012035   Gene: ENSONIG00000009576   Transcript: ENSONIT00000012044
Sequence length 236
Comment pep:novel scaffold:Orenil1.0:GL831273.1:2045046:2049137:-1 gene:ENSONIG00000009576 transcript:ENSONIT00000012044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIIVFFSLLLSVCTVSANLAEADKSSKQQPCPQDTQAVLRELTASVAVQKEQITVLQKE
TEEKTAKLKSEIDQLKLQSTDRAANLETEIDALKQELQATHVAFSTAVVLPGSGPFIGPF
NTETTLIFKHVITNIGNAYNPSTGIFTAPVRGAYHFELHMFGHGGVAVGAYLYKNEGPVV
IAYEHQTAGGELSGSNGASLLLEVGDQVFVRLLNGRRIYDNDNHHTTFSGHLIFTM
Download sequence
Identical sequences I3JT40
XP_003453787.1.78416 ENSONIP00000012035 ENSONIP00000012035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]