SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012230 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012230
Domain Number 1 Region: 386-455,489-557
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000798
Family RUN domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012230   Gene: ENSONIG00000009738   Transcript: ENSONIT00000012239
Sequence length 569
Comment pep:novel scaffold:Orenil1.0:GL831151.1:5357192:5363822:1 gene:ENSONIG00000009738 transcript:ENSONIT00000012239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTDELSASDSEAVLAGAGERWAPVGAVASPEDESGSCGSGAQSRQRCSTSPSEEEMTSR
LRRLEEEQDLLNSSLLALTSHFAQVQFRLKQIVHAQSEEKERMLADLEEFAFRGCPHVVG
CRAQDTKQLENSSEREKRERLEAQREKQKDLIFQLKTQLDDLERFAYQEGSYDLLPQSVV
MERQKVIIDELIKKLDVNLNEDIGNLSPEELRQRVDAAIAQIVNPARVKEQLVEQLKTQI
RDLEMFINFIQDEVGNPLLSDGRSQQPRAAGTNTRSPGAKKKVDPEQAQKMRETGLQLIQ
KALAVLQIFAASQFGCATGHVPQSMWPQDLCVQDYGPLLQRLEAAVEKVRVLGSRRHPSV
EHVVNYTSSSTLGARDELTTSVRKELAIALKDLLAHGLFSPSQTMSVVLAPISCLLPYRP
VPQTMHPWELFVKYYHSKNGKAFVESPARQLSQSFGLHVGAGPVTVTPKQSLLWAIHTVL
KEHGRYKRGPDSEFKALVCMALNEQRLVSWLNLLCKSGTLIHPHYHSWSYMAQTGFEGAL
RILGRISHLRFNLPVDLAVRQLKNIKDAF
Download sequence
Identical sequences I3JTN5
ENSONIP00000012230 XP_003442653.1.78416 ENSONIP00000012230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]