SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012268 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012268
Domain Number 1 Region: 340-396
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000615
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 2 Region: 396-451
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000471
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 3 Region: 294-336
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000942
Family TSP-1 type 1 repeat 0.00093
Further Details:      
 
Domain Number 4 Region: 451-506
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000131
Family TSP-1 type 1 repeat 0.00062
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000012268
Domain Number - Region: 38-94
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0837
Family Spermadhesin, CUB domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012268   Gene: ENSONIG00000009765   Transcript: ENSONIT00000012277
Sequence length 1531
Comment pep:novel scaffold:Orenil1.0:GL831145.1:1895613:2009097:1 gene:ENSONIG00000009765 transcript:ENSONIT00000012277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAVRNLLIYIFSTYLLVMFGLTGAQDYWCSTLVKGVIYGSYSVTEMFPKNYTNCTWTLE
NPDPTKYSIYLKLYKRDLSCSEYSLLAYQFDHYSHEKINELLRVNESIVYLCDSKNIYVF
LLYDKNFVQLRRVFPYDYNGLTPQKLDEEEKSIVEFLVLNKASPSQFGCQVLCTWLENCL
KLEKGTVETCGIVYTKCTCPQHLGDGESESMLMLNNVVLPLNPQTEGCLSPQLQAGQICN
LTAEVKRPPKEEYGMIGEHTVKSQRPRSVHDTKALQEQAESAKFMAQTGESGAEEWSQWS
SCSVTCGQGSQVRTRTCVSPYGTHCSGPLRESRVCNNTAPCPVHGVWEEWSPWSLCSFTC
GRGHRTRTRMCSPPQHGGRACDGPETQTKLCNIALCPVDGQWQEWSSWSDCSVTCANGTQ
QRTRQCSAAAHGGSECRGHWAESRECHNPDCTANGQWNPWGPWSGCSKSCDGGWQRRARV
CQGAAVTGQQCDGSGEEVRKCSDQRCPAPYEICPEDYAVSMVWRRTPSGELAFNRCPPNA
TGTTSRRCSLDHRGMAFWEQPSYARCITNEFRYLQQSVQGHLAKGQRMLAGDGMSQVTKN
LLDLTQRRNFYAGDLLSSVEILRNVTETFKRASYEPSSDDVQNFFQIISNLLEEENKEKW
EDAQKIYPGAVELMQVIEDFIHIVGLGMKDFHNAYLMTGNLVASIQRLPAVSVMTDINFP
MKGRKGMVDWARNSEDKVVIPKGLFVSQSADMEGSPVFILGTVLYKTLGLMLPSPKNHTV
VNSKVIAVTVRPEPKATESHLEIELAHLANGTMNPYCALWDSTIMNDSWGAWSTKGCKTV
LTDASHTKCLCDRVSTFAILAQQPREITMEYSGVPSVTLIVGCGLSCLALITLAVIYAVL
WRYIRSERSIILLNFCLSIVCSNILILVGQTQTHNVSVCIMTTAFLHFFFLASFCWVLTE
AWQSYMAVTGKVRTRLIRKRFLCLGWGLPALVVAVSMGFTKTKGYGTPLYCWLSLEGGLL
YAFVGPAAAVVLVNMVIGILVFNKLVSRDGILDKKLKHRAGQMSEPHTGLTLKCAKCGVV
STTALSATTASNAMASLWSSCVVLPLLALTWMSAVLAMTDKRSILFQILFAVFDSLQGFV
IVMVHCILRREVQDAFRCRLRNCQDPISGDATGTFPNGHAQIMTDFEKDVDIACRSALHK
DMGSCRAATITGTLSRISLNDEEDEKAPEGLNYSTLPGNIISKVIIQQPSALHMPMGMGE
LKEQCMADTTADMRRTVYLCTDDALRQSDQDMGIHDKEGHPMQSQMMETDYIVMPRASAA
VSGSGNVPTLLKDDTKMNITMDTLPHERLMHYKMSPDFNINPSGMDHMNVNLEQQYPSAP
EQMQNLPFEPRTAVKNFLAEMEESTGLSRSETGSTISMSSLERRKSRYSDLDFEKVMHTR
KRHMELFQELNQKFQTLDRFRDIPNMGSMDKAMPNKNPWESYNPACEYQNYATMNVLESD
TKDSLEMTPAEWEKCVNLPLDVQEGDFQTEV
Download sequence
Identical sequences I3JTS3
ENSONIP00000012268 ENSONIP00000012268 XP_019222564.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]