SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012287 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012287
Domain Number 1 Region: 43-189
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.66e-28
Family SPRY domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012287   Gene: ENSONIG00000009779   Transcript: ENSONIT00000012296
Sequence length 217
Comment pep:novel scaffold:Orenil1.0:GL831151.1:5574239:5590480:-1 gene:ENSONIG00000009779 transcript:ENSONIT00000012296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNCAVSKTRIMPVPKKAGRKNSSATEVTLPPYEPNIPEPTTRADFMKYWIPLSFDDKTA
QKLLWISEGGSKVARTSDAVCPYSQRPERYDHSPQVLCKEGLLGHRGYWEVDYDGWVVIG
VVSDSSPRKVQDGPCGIGENKSSWGAGWSGSCYQIWHNAENVDIQLPLSSTMGVYVDQPA
GIIKFLLVEGEDSKNGSQSRETESSSMENTPEAEGIL
Download sequence
Identical sequences I3JTU2
ENSONIP00000012287 ENSONIP00000012287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]