SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012379 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012379
Domain Number 1 Region: 144-274
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.48e-43
Family UAS domain 0.000000392
Further Details:      
 
Domain Number 2 Region: 457-539
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.14e-24
Family UBX domain 0.0000216
Further Details:      
 
Domain Number 3 Region: 26-65
Classification Level Classification E-value
Superfamily UBA-like 0.000000765
Family TAP-C domain-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012379   Gene: ENSONIG00000009852   Transcript: ENSONIT00000012388
Sequence length 540
Comment pep:novel scaffold:Orenil1.0:GL831134.1:6198266:6213312:-1 gene:ENSONIG00000009852 transcript:ENSONIT00000012388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLIYVVVCGGKMAALGDTSAPGVNGLIQQFTAITGATESVGKHMLEACNNNLEMAVTMF
LDGGGIAEEPSTSSSSAASSSRAPSTDEVRAPIPQKQDILVEPEPLFGVPKRRRPARSIF
DGFRDFQTETIRQEQELRNGGTVDKKLSTLADLFRPPIELMHKGSFETAKDCGQMENKWL
MINIQNVQDFACQCLNRDVWSNDSVKTIIREHFIFWQVYHDSEEGQRYIQFYKLNKFPYI
SILDPRTGQKMVEWNQLDVASFLEQATGFLAEHGQLDGPSCHAPPAKRARSESLIDASED
SQLEAAIRASLQETHYESSNVPEPPDSPRSDDESDAEPFSDSEGPFSVDGSDSETPAPHE
EKSSTGKHTATPSAATAAQQRLHPDSSTSSYRKSPYKENNHSHKKEESKKNHLEPSAPGP
RHPQPDSDSGGNHCAPLPESAGTSKISTTTTCDVDCPEDNGPKARLMLRYPDGQREQISL
SSKAKLLALVRHVQSKGYPNERFELVTNFPRRKLAHLDYDITLQEAGLCPQETVFVQERN
Download sequence
Identical sequences I3JU34
ENSONIP00000012379 XP_003438186.4.78416 ENSONIP00000012379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]