SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012655 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000012655
Domain Number - Region: 42-80
Classification Level Classification E-value
Superfamily UBA-like 0.0791
Family UBA domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012655   Gene: ENSONIG00000010063   Transcript: ENSONIT00000012665
Sequence length 338
Comment pep:novel scaffold:Orenil1.0:GL831134.1:7959045:7966253:1 gene:ENSONIG00000010063 transcript:ENSONIT00000012665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTRVAVNQVLRLAVRNATISTLCPRQFGRYYLQSRWCCSSTNQATQHNQDLNPPSGIPV
TELSLRSFIDMGFTESQAEQIYESLANVRRGDSAKHILPTLTALFVLGLNPSSVKKCLEK
CPELYTIKEAQLQQRISNLRKMGLVEGSLQRVVAHYPRILTVPLKRVKNVVMFLKEKCLF
TSQQVTDIIRDCPAVVLENLDQLEYKFQYVYFRMGVKQAEMVKCRLFRYSLDEVRCRHTF
LERRGLYETPDKKGQTTIINPSLDSILNVDQDTFLAHVAQASAEEYDVFKRLAAREWQEE
ELQQGRTEPDSDDEDDDEDVDDDDDIEAKSGYGKRRKK
Download sequence
Identical sequences I3JUW0
ENSONIP00000012655 ENSONIP00000012655 XP_003438221.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]