SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012734 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012734
Domain Number 1 Region: 167-361
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.54e-60
Family Astacin 0.0000713
Further Details:      
 
Domain Number 2 Region: 793-900
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-37
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 3 Region: 368-477
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-37
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 4 Region: 477-586
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.07e-36
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 5 Region: 633-743
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-36
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 6 Region: 924-1017
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-29
Family Spermadhesin, CUB domain 0.00086
Further Details:      
 
Domain Number 7 Region: 744-787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000598
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 8 Region: 589-631
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000952
Family EGF-type module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012734   Gene: ENSONIG00000010127   Transcript: ENSONIT00000012744
Sequence length 1028
Comment pep:novel scaffold:Orenil1.0:GL831212.1:1855151:1913758:1 gene:ENSONIG00000010127 transcript:ENSONIT00000012744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRVPSALAAKMRWITLVLAGLTFWGKVTICNCFDYEEPDYEYYEEERAETIDYKDPCKA
AVFWGDIALDEEDLRMFQIDRTIDLTQHTHMHTHSRQGHTSGGIEEHETVKKRGSLYLLL
ERIRRFGFDYLPKNDSKEAASPKSQSGKAGKNGKFVKTRIPRAATSRAERIWPGGVIPYV
IGGNFTGSQRAMFKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYVGRRGNGPQA
ISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVN
SLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDIAQARKLYR
CPACGETLQESTGNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSSLCWYD
YIEVRDGYWRKAPLLGRFCGDKVPDVLISTDSRMWIEFRSSSNWVGKGFAAIYEAICGGE
ITKDSGQIQSPNYPDDYRPSKECVWRISVSEGYNVGLSFQAFEIERHDSCAYDYLEVRDG
PLETSPLIGRFCGYDKPEDVRSTSHTLWMKFVSDGTVNKAGFAANFFKEDDECAKPDNGG
CEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLSKLNGTISTPGWPKEYPPNKNCV
WQVVAPTQYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSKLHGKYCGTEVPEVITSQY
NNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTVGSYVCQCRHGFVLHEN
KHDCKEAECEHKIHSPSGTLSSPNWPDKYPSRKECTWDITATPGHRVKITFNEFEIEQHQ
ECAYDHLEAFDGDSDTAAILGRLCGSKIPESLVSTGNKMYLRFISDASVQRKGFQASHST
ECGGRLKAEAHQKNLYSHSQFGDNNYPGHTDCEWLLTAEQGYGIELSFITFEVEEEADCG
YDYIELYNGYDANSHRLGRFCGSGPREGIYSPGDAMLIRFHSDDTISKKGFHILYTSTKF
QENLHTRK
Download sequence
Identical sequences I3JV39
ENSONIP00000012734 XP_003449738.1.78416 XP_013129570.1.78416 ENSONIP00000012734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]