SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012830 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000012830
Domain Number - Region: 243-395
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.000194
Family HBL-like 0.011
Further Details:      
 
Domain Number - Region: 215-243
Classification Level Classification E-value
Superfamily BLRF2-like 0.0222
Family BLRF2-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012830   Gene: ENSONIG00000010205   Transcript: ENSONIT00000012840
Sequence length 464
Comment pep:novel scaffold:Orenil1.0:GL831212.1:2839228:2844075:1 gene:ENSONIG00000010205 transcript:ENSONIT00000012840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNVSINNTDNDVLRDKMRSYSVLNTLYHETRQEIDLLNRQISVKDGVIADLKARLGRHE
RLYMTVGDKESVLISPSNSLVESLLNEICKLKQKKNEGDLKAARQAEEIQRLNTQLREKE
LELETIRCQPDHEKDQEIQRLRVALQERERAEATRSVLCTSLAEEADQLRGQLGATVKVC
QELMARLEKDKRGGGEVEDVALTQKNTEMPESSEMGSLNAQIRQLQEENQQLKQRVAYVQ
SLNTQWQKYDSSREDYIRGLCQRLKDSTGQGLMPAMGSTNTGLLHQEISRLNGLLEEKMR
ECARLAREIDDIRRQDKEQIQTLEQQVLIYTDDFKSERADRERAQGQIDALKEQVSQLKQ
QLHKQQGASRESRDVVPLCHVHIGHRISSKRSKDTSEPLLRTTAERRQQQQQQHQQPAAA
AATPNSAWNEHPGMSELQCPQCLATFSDTKAAEYLNHCLECARV
Download sequence
Identical sequences I3JVD5
XP_005469845.1.78416 ENSONIP00000012830 ENSONIP00000012830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]