SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012880 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012880
Domain Number 1 Region: 12-242
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.31e-74
Family BAR domain 0.000000049
Further Details:      
 
Domain Number 2 Region: 282-346
Classification Level Classification E-value
Superfamily SH3-domain 5.78e-23
Family SH3-domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012880   Gene: ENSONIG00000010245   Transcript: ENSONIT00000012890
Sequence length 349
Comment pep:novel scaffold:Orenil1.0:GL831134.1:9576054:9587251:-1 gene:ENSONIG00000010245 transcript:ENSONIT00000012890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGFKKQIYKATQLMSEKVGGAEGTKLDEDFKDLERKADITSKAVVEVLNKTSEYIQP
NPATRAKLSMLSTVSKIRGQVNSPGYPQAEGLLGECMTKYGHEMGENSNFGGALIDAGES
MKRLAEVKDALDIDVKQNFIDPLQGIAEKDIKDIQFHLKKLEGRRLDYDYKKKRQGKIQD
EEIRQALEKFHESKELAERSMYNLLETDVEQVSQLSSFVESLLQYHRQATQIMEELSDKL
RERVNDAQSRPRQEYTPKPKPAFDFGEVEHSNGGYSSSASSPPAYSSAEPCCKAMYDFEP
ENDGELGFQEGDIIKLVSQIDENWYEGSLRGKSGYFPTNYVEVMVPLPH
Download sequence
Identical sequences I3JVI5
ENSONIP00000012880 ENSONIP00000012880 XP_003438246.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]