SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012898 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012898
Domain Number 1 Region: 690-1041
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.45e-118
Family Hect, E3 ligase catalytic domain 0.000000109
Further Details:      
 
Domain Number 2 Region: 2-375
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 9.16e-104
Family Regulator of chromosome condensation RCC1 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012898   Gene: ENSONIG00000010256   Transcript: ENSONIT00000012908
Sequence length 1047
Comment pep:novel scaffold:Orenil1.0:GL831145.1:6842021:6858654:1 gene:ENSONIG00000010256 transcript:ENSONIT00000012908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCWGNASYGQLGLGGIDEEIVVEPRKCEFFHGKQVSDVGCGRRHTAFLLEDGTVYTCGC
NDLGQLGHEKARKKPEQVVALDAQIIVAVSCGEAHTLALNDKGQVFSWGLGSDGQLGLNN
FEECVRVPRNIKTLSDVQIAQVACGYWHSHALSKGGHIFSWGQNRYGQLGLGINGQSIST
PQMIQSLQGIPFAQISAGGAHSFALTPSGAVFGWGRNNFGQLGLNDCNDRYFPALLKSLR
SQRVIYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTNHEINPRKVFELMGNVVTQIA
CGRQHTLAFTPSSGKMDSFGLGGNGQLGTRSTSNRKSPALVKGPWVATSTATDTDSEEKC
CVKRIYAGGDQSFAHYCSANSLQNGDDTRIKDPQRKICSLNEDLIQKWLNHSPGRLPLDI
SNEIDLVFSSASCLNGSFLSMSHPDHYSTSSKCSGVDMNMARLLFNKVIQEGHPEIAQQI
AASLEKNLIPRLNNSPPDIEALRLYLTLPECPLFTNRNNYVTISIPFAKSVISLKEAPLK
VLGNWWSTFESPVFQRLVKLYKEVVVYLLQMHKVGIPAVEQRIFTCFLDTSLRLLEILHK
VSEKAGHIIQYDKFYIHELDNLIDIRNDYVTWLQRQMYPMGHDGVVTLCKYPFVFDAQAK
TTLLQTDAVIQMQIAVDQAQMQNFSSMFLPAVESVNPCLILIVRRENIVGDTMEVLRKSK
NVDYKKPLKVIFVGEEAVDAGGVRKEFFLLIMKELLDPKYGMFRYYEESRLIWFSNKTFE
DIDLFNLIGVICGLAIYNLTIVELNFPLALYKKLLKKKPTLEDLKELMPDVGRSLQQLLD
YTEDDLEETFCLNFTITEENYGATEVFELVPNGENINVNMSNRQDFVNAYVDYVFNTSVA
PLFECFYAGFHKVCGGKVLELFQPNELQAMVIGNTNYDWMELEKTTEYKGEYWTDHPTIR
LFWEVFHDLPLEKKKQFLLFLTGSDRIPILGMKSLKLVIQPTGGGEHYLPVAHTCFNLLD
LPKYTSLEMLREKLLQAIDHNQGFNLA
Download sequence
Identical sequences I3JVK3
ENSONIP00000012898 XP_005473907.1.78416 ENSONIP00000012898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]