SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013251 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013251
Domain Number 1 Region: 185-290
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-26
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 2 Region: 2-96
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-26
Family Kringle modules 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013251   Gene: ENSONIG00000010539   Transcript: ENSONIT00000013261
Sequence length 450
Comment pep:novel scaffold:Orenil1.0:GL831281.1:85685:122028:1 gene:ENSONIG00000010539 transcript:ENSONIT00000013261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TECYTANGEDYRGFQNQTSLHGGKPCLFWNETFQHPYNTLKYPNGEGGLGSHNYCRNPDG
DVQPWCYIADHEDGIYWRYCDIPTCQMPGNLGCFRDSGDPPTLTGASETSNKLTIQNCIS
FCRKQRYKLAGMESGYACFCGNDVDLQKRGESPSMECNHVCFGDHTQPCGGDGWVIIFST
RVGACGGNYTSPSGVIYSPDFPDKYGAGRVCYWTIQVPGSSAILFNFTFFDISDQTDMVE
LLDGYTNQVVARFDWRSPPRELVNITGDFVILYFYSDRTNQAQGFALLYQDLISLQNISM
PPGDDEDENEDVSSTAGPQLAGGVTEKSNGTTNGRSSQILYVITSSPGKPEHNMPGQWAG
RGETTGHSAMWTIYALAALLILTVIAMVAKLLLHVTVKSPNIPTVSGSDTCSQSTASSEP
WIILYRPSTISLFKKKLKNHHGDLSPLVGN
Download sequence
Identical sequences I3JWK6
ENSONIP00000013251 ENSONIP00000013251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]