SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013433 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013433
Domain Number 1 Region: 168-244
Classification Level Classification E-value
Superfamily UBA-like 2.3e-19
Family UBA domain 0.0014
Further Details:      
 
Domain Number 2 Region: 8-101
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.53e-17
Family Ubiquitin-related 0.01
Further Details:      
 
Domain Number 3 Region: 297-348
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000175
Family UBA domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013433   Gene: ENSONIG00000010682   Transcript: ENSONIT00000013443
Sequence length 423
Comment pep:novel scaffold:Orenil1.0:GL831281.1:1687213:1692471:-1 gene:ENSONIG00000010682 transcript:ENSONIT00000013443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVQEEKIFAGKVLKIHICTMDGTEWLEEVTEDTTVEKLKERCLKHCVHGSLEDPKTLTH
HKLIHAATERVLSDTKTVADENLKDKDVLLLIKKRPPPTPPKTADVSSEDKKKQENKAPD
KDAILKATASLSTRHTDRTVTQHNIRDFQTELRKILVSLIEVAQKLLALNPDAVELFKKA
NAMLDEDEEDRVDETALQQLTEMGFPESRAIKALRLNHMSVTQAMEWLIEHVDDPSVDTP
LPGQDSSGAAGATAAATPGPPASASASASGPNPHRSLSSQSSTDESNKQDELTEIFKRIR
RKREFRPDSRAVIALMEMGFDEKEVIDALRVNNNQQDAACEWLLGDRKPSPEDLDKGIDT
NSPLFQAILENPVVQLGLTNPKTLLAFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTL
NRT
Download sequence
Identical sequences I3JX38
ENSONIP00000013433 XP_004566802.1.88231 XP_006803895.1.46954 XP_014191151.1.24487 ENSONIP00000013433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]